DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment svr and CPZ

DIOPT Version :9

Sequence 1:NP_001284744.1 Gene:svr / 30998 FlyBaseID:FBgn0004648 Length:1439 Species:Drosophila melanogaster
Sequence 2:NP_001014447.2 Gene:CPZ / 8532 HGNCID:2333 Length:652 Species:Homo sapiens


Alignment Length:559 Identity:197/559 - (35%)
Similarity:269/559 - (48%) Gaps:145/559 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly     2 PTLGLLFASIGIAVLAMGVPHCRG-------------------------------------YTIK 29
            |.|.||    |.||||   |.|.|                                     |..:
Human    95 PDLRLL----GCAVLA---PRCEGGWVRRPCRHICEGLREVCQPAFDAIDMAWPYFLDCHRYFTR 152

  Fly    30 EDESFLQQPHYASQEQLEDLFAGLE--KAYP------------------------------NQAK 62
            |||        ...:.||.|..|||  :|.|                              :.|:
Human   153 EDE--------GCYDPLEKLRGGLEADEALPSGLPPTFIRFSHHSYAQMVRVLRRTASRCAHVAR 209

  Fly    63 VHFLGRSLEGRNLLALQISRNTRSRNLLTPPVKYIANMHGDETVGRQLLVYMAQ-----YLLGNH 122
            .:.:|||.:||.||.::.|.......|:.|.||.|.|:||:|..||::|:|:||     ||||| 
Human   210 TYSIGRSFDGRELLVIEFSSRPGQHELMEPEVKLIGNIHGNEVAGREMLIYLAQYLCSEYLLGN- 273

  Fly   123 ERISDLGQLVNSTDIYLVPTMNPDGYAL-SQEGNCESLPNY----VGRGNAANIDLNRDFPDRLE 182
            .||.   :|:|:|.|:|:|:||||||.: :.||     ..|    .||.||.|:||||:|||.  
Human   274 PRIQ---RLLNTTRIHLLPSMNPDGYEVAAAEG-----AGYNGWTSGRQNAQNLDLNRNFPDL-- 328

  Fly   183 QSHVHQLRAQSR------------------QPETAALVNWIVSKPFVLSANFHGGAVVASYPYDN 229
            .|..::| |::|                  .|||.|::.|:.:.||||||:.|||.:|.|||:|.
Human   329 TSEYYRL-AETRGARSDHIPIPQHYWWGKVAPETKAIMKWMQTIPFVLSASLHGGDLVVSYPFDF 392

  Fly   230 SLAHNECCEESLTPDDRVFKQLAHTYSDNHPIM--RKGNNCNDSF--SGGITNGAHWYELSGGMQ 290
            |....|....|.|||:::||.|:..|:|.||:|  |..|.|..:|  .|.|.|||.||..:|||.
Human   393 SKHPQEEKMFSPTPDEKMFKLLSRAYADVHPMMMDRSENRCGGNFLKRGSIINGADWYSFTGGMS 457

  Fly   291 DFNYAFSNCFELTIELSCCKYPAASTLPQEWQRNKASLLQLLRQAHIGIKGLVTDASGFPIADAN 355
            ||||..:||||:|:||.|.|:|....|...||.||.|||..:...|.||||:|||..|.|:.:|.
Human   458 DFNYLHTNCFEITVELGCVKFPPEEALYILWQHNKESLLNFVETVHRGIKGVVTDKFGKPVKNAR 522

  Fly   356 VYVAGLEEKPMRTSKRGEYWRLLTPGLYSVHASAFGYQTSAPQQVRVTNDNQEALRLDFKLAPV- 419
            :.|.|:.. .:.|:..|:|||||.||::.|.|.|.|| ....::|.:....:.|.|:||.|.|: 
Human   523 ISVKGIRH-DITTAPDGDYWRLLPPGIHIVIAQAPGY-AKVIKKVIIPARMKRAGRVDFILQPLG 585

  Fly   420 --ETNFDGNFRKVKV-----------ERSEP-PQKLKKQ 444
              ..||....|:...           |.:|| |.:.::|
Human   586 MGPKNFIHGLRRTGPHDPLGGASSLGEATEPDPLRARRQ 624

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
svrNP_001284744.1 M14_CPD_I 40..334 CDD:199850 139/357 (39%)
Peptidase_M14NE-CP-C_like 338..416 CDD:200604 31/77 (40%)
M14_CP_N-E_like 456..759 CDD:199842
Peptidase_M14NE-CP-C_like 763..839 CDD:200604
CarbopepD_reg_2 1125..1202 CDD:290434
CarboxypepD_reg 1223..1301 CDD:290350
CPZNP_001014447.2 CRD_Carboxypeptidase_Z 40..167 CDD:143556 19/86 (22%)
M14_CPZ 187..501 CDD:199849 131/325 (40%)
Peptidase_M14NE-CP-C_like 505..581 CDD:200604 31/77 (40%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 595..629 6/30 (20%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 56 1.000 Domainoid score I10989
eggNOG 1 0.900 - - E1_KOG2649
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D101221at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11532
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
54.920

Return to query results.
Submit another query.