DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment svr and CG4408

DIOPT Version :9

Sequence 1:NP_001284744.1 Gene:svr / 30998 FlyBaseID:FBgn0004648 Length:1439 Species:Drosophila melanogaster
Sequence 2:NP_651141.2 Gene:CG4408 / 42762 FlyBaseID:FBgn0039073 Length:479 Species:Drosophila melanogaster


Alignment Length:370 Identity:76/370 - (20%)
Similarity:136/370 - (36%) Gaps:126/370 - (34%)


- Green bases have known domain annotations that are detailed below.


  Fly   401 RVTNDNQEALRLDFKLAPVETNFDGNFRKVKVERSEPPQKLKKQFNGFLTPTKYEHHNFTAMESY 465
            ||.|.|.:||            .|.|:.:|..|.::|.:...|::           |...::.::
  Fly   147 RVLNYNFQAL------------IDA
NYLEVAPEDTKPEEFDWKRY-----------HPLESINAW 188

  Fly   466 LRAISSSYPSLTRLYSIGKSVQGRDLWVLEI----------FATPGSHVPGVPEFKYVANMHGNE 520
            |:.::.::|.:. |..:|.|.|||.:..::|          |...|.|                 
  Fly   189 LKKLAETHPEVL-LVELGVSAQGRPILGVQIAFDNENRTTVFVESGIH----------------- 235

  Fly   521 VVGKELLLILT-KYMLERYGN--DDRITKLVNGTRMHFLYSMNPDGYEISIEGDRTGGVGRA--- 579
              .:|.:...| .|::::..|  |..:..|....|.:...::|||||:.:.:|||.....||   
  Fly   236 --AREWIAPATATYIIDQLVNSKDSAVQALARSQRWYIFPTVNPDGYQYTFKGDRMWRKNRALFG 298

  Fly   580 NAHGIDLNRNFPDQYGTD-------RFNKVTEPEVAAVMNWTLSLPFV----------LSANLHG 627
            ...|:|||||||..:...       |:: .:.|..|:.:.....:.|:          ...:||.
  Fly   299 ICRGVDLNRNFPFHWNVTGASGDPCRYD-YSGPSAASEVETQRMIEFIRHRVESERIRTFISLHS 362

  Fly   628 GSLVANYPFD------DNENDFNDPFMRLRN--SSINGRKPNPTEDNALFKHLAGIYSNAHPTMY 684
            .|.:..:|:.      ||.:|..|......|  ..::||         ::|. ..||...:|:  
  Fly   363 YSQMIMFPYGHSAERVDNYHDLTDIGKLAANKIKDVSGR---------IYKS-GSIYETIYPS-- 415

  Fly   685 LGQPCELFQNEFFPDGITNGAQWYSVTGGMQDWNYVRAGCLELTI 729
                                      :||.:||.:   |.|::.|
  Fly   416 --------------------------SGGSKDWAH---GQLKIPI 431

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
svrNP_001284744.1 M14_CPD_I 40..334 CDD:199850
Peptidase_M14NE-CP-C_like 338..416 CDD:200604 6/14 (43%)
M14_CP_N-E_like 456..759 CDD:199842 64/315 (20%)
Peptidase_M14NE-CP-C_like 763..839 CDD:200604
CarbopepD_reg_2 1125..1202 CDD:290434
CarboxypepD_reg 1223..1301 CDD:290350
CG4408NP_651141.2 Propep_M14 88..159 CDD:280416 6/23 (26%)
M14_CP_A-B_like 179..472 CDD:199844 64/326 (20%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 1 0.950 - 0 Normalized mean entropy S4288
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.860

Return to query results.
Submit another query.