DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment svr and Cpe

DIOPT Version :9

Sequence 1:NP_001284744.1 Gene:svr / 30998 FlyBaseID:FBgn0004648 Length:1439 Species:Drosophila melanogaster
Sequence 2:NP_037260.2 Gene:Cpe / 25669 RGDID:2394 Length:476 Species:Rattus norvegicus


Alignment Length:405 Identity:166/405 - (40%)
Similarity:235/405 - (58%) Gaps:49/405 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly   454 YEHHNFTAMESYLRAISSSYPSLTRLYSIGKSVQGRDLWVLEIFATPGSHVPGVPEFKYVANMHG 518
            :|:|.:..:...|.::.....:::|:|::|:|.:||:|.|:|:...||.|.||.|||||:.||||
  Rat    51 FEYHRYPELREALVSVWLQCTAISRIYTVGRSFEGRELLVIELSDNPGVHEPGEPEFKYIGNMHG 115

  Fly   519 NEVVGKELLLILTKYMLERY--GNDDRITKLVNGTRMHFLYSMNPDGYE--ISIEGD-RTGGVGR 578
            ||.||:|||:.|.:|:...|  || :.|..|::.||:|.:.|:||||:|  .|..|: :...|||
  Rat   116 NEAVGRELLIFLAQYLCNEYQRGN-ETIVNLIHSTRIHIMPSLNPDGFEKAASQPGELKDWFVGR 179

  Fly   579 ANAHGIDLNRNFPDQYGTDRFNKVTE------------------------PEVAAVMNWTLSLPF 619
            :||.||||||||||   .||...|.|                        ||..||::|.:.:||
  Rat   180 SNAQGIDLNRNFPD---LDRIVYVNEKEGGPNNHLLKNLKKIVDQNSKLAPETKAVIHWIMDIPF 241

  Fly   620 VLSANLHGGSLVANYPFDDNENDFNDPFMRLRNSSINGRKPNPTEDNALFKHLAGIYSNAHPTMY 684
            |||||||||.||||||:|:.           |:.:.:.....|  |:|:|:.||..||:.:|.|.
  Rat   242 VLSANLHGGDLVANYPYDET-----------RSGTAHEYSSCP--DDAIFQSLARAYSSFNPVMS 293

  Fly   685 --LGQPCELFQNE-FFPDGITNGAQWYSVTGGMQDWNYVRAGCLELTIEMGCDKFPKAAELSRYW 746
              ...||....:: .|.||.|||..||||.|||||:||:.:.|.|:|:|:.|:|||....|..||
  Rat   294 DPNRPPCRKNDDDSSFVDGTTNGGAWYSVPGGMQDFNYLSSNCFEITVELSCEKFPPEETLKSYW 358

  Fly   747 EDHREPLLQFIEQVHCGIHGFVHSTIGTPIAGAVVRLDGANHSTYSQVFGDYWKLALPGRHNLTV 811
            ||::..|:.::||:|.|:.|||....|.|||.|.:.:||.:|...|...||||:|..||.:.||.
  Rat   359 EDNKNSLINYLEQIHRGVKGFVRDLQGNPIANATISVDGIDHDVTSAKDGDYWRLLAPGNYKLTA 423

  Fly   812 LGDNYAPLRMEVEVP 826
            ....|..:..:|.||
  Rat   424 SAPGYLAITKKVAVP 438

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
svrNP_001284744.1 M14_CPD_I 40..334 CDD:199850
Peptidase_M14NE-CP-C_like 338..416 CDD:200604
M14_CP_N-E_like 456..759 CDD:199842 136/334 (41%)
Peptidase_M14NE-CP-C_like 763..839 CDD:200604 26/64 (41%)
CarbopepD_reg_2 1125..1202 CDD:290434
CarboxypepD_reg 1223..1301 CDD:290350
CpeNP_037260.2 M14_CPE 53..371 CDD:349437 136/334 (41%)
Peptidase_M14NE-CP-C_like 375..449 CDD:200604 26/64 (41%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 57 1.000 Domainoid score I10592
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D101221at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11532
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
44.020

Return to query results.
Submit another query.