DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment svr and CPXM2

DIOPT Version :9

Sequence 1:NP_001284744.1 Gene:svr / 30998 FlyBaseID:FBgn0004648 Length:1439 Species:Drosophila melanogaster
Sequence 2:NP_937791.2 Gene:CPXM2 / 119587 HGNCID:26977 Length:756 Species:Homo sapiens


Alignment Length:652 Identity:193/652 - (29%)
Similarity:285/652 - (43%) Gaps:167/652 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly   271 SFSGGITNGAH-WYELSGGMQDFNYAFSNCFELTIELSCCKYPAASTL----PQEWQRNKASLLQ 330
            |:...::|.:| |..:..|..|..:..::..|:.: |:....|..:..    ||.|..|.:..::
Human   224 SYKVMVSNDSHTWVTVKNGSGDMIFEGNSEKEIPV-LNELPVPMVARYIRINPQSWFDNGSICMR 287

  Fly   331 LLRQAHIGIKGLVTDASGFPIADANVYVAGLEEKPMRTSKRGEYWRLLTPGLYSVHASAFGYQTS 395
            :             :..|.|:.|.|.|                |.|                   
Human   288 M-------------EILGC
PLPDPNNY----------------YHR------------------- 304

  Fly   396 APQQVRVTNDNQEALRLDFKLAPVETNFDGNFRKVKVERSEPPQKLKKQFNGFLTPTKYEHHNFT 460
             ..::..|:|      ||||                                        |||:.
Human   305 -RNEMTTTDD------LDFK----------------------------------------HHNYK 322

  Fly   461 AMESYLRAISSSYPSLTRLYSIGKSVQGRDLWVLEIFATPGSHVPGVPEFKYVANMHGNEVVGKE 525
            .|...::.::...|::||:|:||||.||..|:.:||...||.|..|.|||.|:|..|||||:|:|
Human   323 EMRQLMKVVNEMCPNITRIYNIGKSHQGLKLYAVEISDHPGEHEVGEPEFHYIAGAHGNEVLGRE 387

  Fly   526 LLLILTKYMLERY-GNDDRITKLVNGTRMHFLYSMNPDGYEISIE-GDRTGG--VGRANAHGIDL 586
            |||:|.:::.:.| ..:.||..||..||:|.|.|:||||||.:.| |...||  :||....|||:
Human   388 LLLLLVQFVCQEYLARNARIVHLVEETRIHVLPSLNPDGYEKAYEGGSELGGWSLGRWTHDGIDI 452

  Fly   587 NRNFPD-----QYGTDRFN---KV-----------------TEPEVAAVMNWTLSLPFVLSANLH 626
            |.||||     ....||.|   ||                 ...|..||:.|...:||||..||.
Human   453 NNNFPDLNTLLWEAEDRQNVPRKVPNHYIAIPEWFLSENATVAAETRAVIAWMEKIPFVLGGNLQ 517

  Fly   627 GGSLVANYPFDDNENDFNDPFMRLRNSSINGRKPNPTEDNALFKHLAGIYSNAHPTM--YLGQPC 689
            ||.||..||:|            |..|....::..||.|:.:|:.||..|::.|..|  ...:.|
Human   518 GGELVVAYPYD------------LVRSPWKTQEHTPTPDDHVFRWLAYSYASTHRLMTDARRRVC 570

  Fly   690 --ELFQNEFFPDGITNGAQWYSVTGGMQDWNYVRAGCLELTIEMGCDKFPKAAELSRYWEDHREP 752
              |.||.|   :|..|||.|::|.|.:.|::|:...|.||:|.:||||:|..::|...||::||.
Human   571 HTEDFQKE---EGTVNGASWHTVAGSLNDFSYLHTNCFELSIYVGCDKYPHESQLPEEWENNRES 632

  Fly   753 LLQFIEQVHCGIHGFVHSTIGTPIAGAVVRLDGANHSTYSQVFGDYWKLALPGRHNLTVLGDNYA 817
            |:.|:||||.||.|.|..:.|..|..|::.::|.||...:...||||:|..||.:.:|...:.:.
Human   633 LIVFMEQVHRGIKGLVRDSHGKGIPNAIISVEGINHDIRTANDGDYWRLLNPGEYVVTAKAEGFT 697

  Fly   818 PLRMEVEVPDVHPFEM---RMDITLMPDDPQHWASANDFRIIENVVNTRYHTNP-QVRARLAELE 878
            .......|    .::|   |.|.||        :..|..||.|  :..::...| .:.||..:|.
Human   698 ASTKNCMV----GYDMGATRCDFTL--------SKTNMARIRE--IMEKFGKQPVSLPARRLKLR 748

  Fly   879 NQ 880
            .|
Human   749 GQ 750

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
svrNP_001284744.1 M14_CPD_I 40..334 CDD:199850 13/67 (19%)
Peptidase_M14NE-CP-C_like 338..416 CDD:200604 12/77 (16%)
M14_CP_N-E_like 456..759 CDD:199842 130/335 (39%)
Peptidase_M14NE-CP-C_like 763..839 CDD:200604 22/78 (28%)
CarbopepD_reg_2 1125..1202 CDD:290434
CarboxypepD_reg 1223..1301 CDD:290350
CPXM2NP_937791.2 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 51..131
FA58C 137..292 CDD:238014 13/81 (16%)
FA58C 138..293 CDD:214572 13/82 (16%)
M14_CPX_like 314..639 CDD:199851 134/379 (35%)
Peptidase_M14NE-CP-C_like 643..718 CDD:200604 22/78 (28%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 61 1.000 Domainoid score I10468
eggNOG 1 0.900 - - E1_KOG2649
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D101221at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11532
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
54.920

Return to query results.
Submit another query.