DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment svr and cpz

DIOPT Version :9

Sequence 1:NP_001284744.1 Gene:svr / 30998 FlyBaseID:FBgn0004648 Length:1439 Species:Drosophila melanogaster
Sequence 2:XP_012812537.1 Gene:cpz / 100170588 XenbaseID:XB-GENE-994183 Length:662 Species:Xenopus tropicalis


Alignment Length:448 Identity:179/448 - (39%)
Similarity:246/448 - (54%) Gaps:58/448 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly    33 SFLQQPHYASQEQLEDLFAGLEK--AYPNQ-AKVHFLGRSLEGRNLLALQISRNTRSRNLLTPPV 94
            :|:|..|::    ..|:...|:|  |..:| :|.:.:|||.||::|||::.|........|||..
 Frog   186 TFIQFIHHS----YSDMVRVLKKTAARCSQISKTYSIGRSYEGKDLLAIEFSAQPGQHKALTPEF 246

  Fly    95 KYIANMHGDETVGRQLLVYMAQ-----YLLGNHERISDLGQLVNSTDIYLVPTMNPDGY--ALSQ 152
            :||.||||:|..||:||:|:||     |||||    |.:..|:|:|.|:|:|:||||||  |..:
 Frog   247 RYIGNMHGNEVAGRELLIYLAQFLCSEYLLGN----SRIQTLINTTRIHLLPSMNPDGYEHAAEE 307

  Fly   153 EGNCESLPNYVGRGNAANIDLNRDFPDRLEQSHVHQLRAQSR---------------QPETAALV 202
            ........|  ||.||.||||||:|||...:.|.......:|               .||..|::
 Frog   308 GAGYNGWTN--GRLNAQNIDLNRNFPDLTSEVHKIIRMPMARLDHMPIPESYWDGKIAPEAKAVM 370

  Fly   203 NWIVSKPFVLSANFHGGAVVASYPYDNSLAHNECCEESL---TPDDRVFKQLAHTYSDNHPIM-- 262
            .|:.|.|||:|.:.|||.:|.|||||.|   ....||.:   |||::||:.|..||...||||  
 Frog   371 KWMRSIPFVISGSLHGGDLVVSYPYDFS---RHPLEEKMFSPTPDEKVFQMLVKTYVAAHPIMSD 432

  Fly   263 ----RKGNNCNDSFSGGITNGAHWYELSGGMQDFNYAFSNCFELTIELSCCKYPAASTLPQEWQR 323
                |.|.|.|:  .|||.|||.||..||||.||:|..:||||||:||.|.|:|....|...||.
 Frog   433 KSTSRCGGNFNN--KGGIINGAEWYSFSGGMADFSYLHTNCFELTLELGCEKFPTEDELYSIWQN 495

  Fly   324 NKASLLQLLRQAHIGIKGLVTDASGFPIADANVYVAGLEEKPMRTSKRGEYWRLLTPGLYSVHAS 388
            ||.::|.|:...|.||||.|.|..|.||..|.:.|.|:.. .:.|.:.|:|:|||.||.|.|.|.
 Frog   496 NKEAMLSLIEMVHRGIKGFVKDEHGNPIKKARISVKGIRH-DITTGEDGDYFRLLIPGSYIVSAE 559

  Fly   389 AFGYQTSAPQQVRVTNDNQEALRLDFKLAPVETNFDGNFRKVKVERSEPPQKLKKQFN 446
            |||| :...:::.:.....:|.|:||.|..|:.. :..|.||      .|:.:.::|:
 Frog   560 AFGY-SKVTKKITLPAKMLKAGRVDFALQRVDVK-NRKFHKV------APEDIYERFD 609

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
svrNP_001284744.1 M14_CPD_I 40..334 CDD:199850 137/327 (42%)
Peptidase_M14NE-CP-C_like 338..416 CDD:200604 31/77 (40%)
M14_CP_N-E_like 456..759 CDD:199842
Peptidase_M14NE-CP-C_like 763..839 CDD:200604
CarbopepD_reg_2 1125..1202 CDD:290434
CarboxypepD_reg 1223..1301 CDD:290350
cpzXP_012812537.1 CRD_FZ 46..169 CDD:382974
M14_CPZ 192..506 CDD:349439 138/328 (42%)
Peptidase_M14NE-CP-C_like 510..586 CDD:200604 31/77 (40%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 57 1.000 Domainoid score I10678
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D101221at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11532
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
55.020

Return to query results.
Submit another query.