DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cyp4g1 and CYP702A1

DIOPT Version :9

Sequence 1:NP_525031.1 Gene:Cyp4g1 / 30986 FlyBaseID:FBgn0010019 Length:556 Species:Drosophila melanogaster
Sequence 2:NP_176744.1 Gene:CYP702A1 / 842878 AraportID:AT1G65670 Length:482 Species:Arabidopsis thaliana


Alignment Length:566 Identity:109/566 - (19%)
Similarity:205/566 - (36%) Gaps:167/566 - (29%)


- Green bases have known domain annotations that are detailed below.


  Fly    28 LTTLVGTLVAMALYEYWRRNSREYRMVANIPSPPE--------LPILGQA------HVA---AGL 75
            |.|::.:|:.:.|: :|...|:.       |.|.|        .||:|:.      |.|   ...
plant     7 LLTVMVSLIVVKLF-HWIYQSKN-------PKPNEKLPPGSMGFPIIGETFEFMKPHDAFQFPTF 63

  Fly    76 SNAEILAVGLGYLNKYGETMKAWLGNVLLVFLTNPSDIELIL----SGH-QHLTKAEEYRYFKPW 135
            ....|:        :||...:..|....::..|   ||||.:    :.| ..|||:     ....
plant    64 IKERII--------RYGPIFRTSLFGAKVIIST---DIELNMEIAKTNHAPGLTKS-----IAQL 112

  Fly   136 FGD-GLLISNGHHWRHHRKMIAPTFHQSILKSFVPTFVDHSKAVVARMGLEAGK---SFDVHDYM 196
            ||: .|...:....:|.|.:.........||..|...:|    ::.|..:|.|.   ..||.:..
plant   113 FGENNLFFQSKESHKHVRNLTFQLLGSQGLKLSVMQDID----LLTRTHMEEGARRGCLDVKEIS 173

  Fly   197 SQTTVDILLSTAMGVKKLPEGNKSFEYAQAVVDMCDIIHKRQVKLLYRL--------------DS 247
            |:..::.|.....|..: ||..|                  ::.|.:|.              ..
plant   174 SKILIECLAKKVTGDME-PEAAK------------------ELALCWRCFPSGWFRFPLNLPGTG 219

  Fly   248 IYKFTKLREKGDRMMNIILGMTSKVVKDRKENFQEESRAIVEEISTPVASTPASKKEGLRDDLDD 312
            :||..|.|:   ||::::           ||...:: ||..||:.                    
plant   220 VYKMMKARK---RMLHLL-----------KETILKK-RASGEELG-------------------- 249

  Fly   313 IDENDVGAKRRLALLDAMVEMAKNPDIEWNEKDIMDEVNTIMFEGHDTTSAGSSFALCMMGIHKD 377
                        .....:.|.|:...::    :.::.:.|:....::||....:..:.::..:..
plant   250 ------------EFFKIIFEGAETMSVD----NAIEYIYTLFLLANETTPRILAATIKLISDNPK 298

  Fly   378 IQAKVFAEQKAIFGDNMLRD--CTFADTMEMKYLERVILETLRLYPPVPLIARRLDYDLKLASGP 440
            :..::..|.:.|......::  .|:.:...|.:.:.||.|:||:....|.:.|..|::.::  |.
plant   299 VMKELHREHEGIVRGKTEKETSITWEEYKSMTFTQMVINESLRITSTAPTVFRIFDHEFQV--GS 361

  Fly   441 YTVPKGTTVIVLQY-CVHRRPDIYPNPTKFDPDNFLPERMANRHYYSFIPFSAGPRSCVGRKYAM 504
            |.:|.|.  |.:.| ..|..|..|.:|..|:|..:..:.:......::|||.||.|.|||.::|.
plant   362 YKIPAGW--IFMGYPNNHFNPKTYDDPLVFNPWRWEGKDLGAIVSRTYIPFGAGSRQCVGAEFAK 424

  Fly   505 LKLKVLL-------------STIVRNYIV---------HSTDTEAD 528
            |::.:.:             :||:||:::         ...|||.|
plant   425 LQMAIFIHHLSRDRWSMKIGTTILRNFVLMFPNGCEVQFLKDTEVD 470

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cyp4g1NP_525031.1 p450 58..518 CDD:278495 98/515 (19%)
CYP702A1NP_176744.1 p450 8..440 CDD:386267 100/533 (19%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1247045at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.