DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cyp4g1 and CYP96A3

DIOPT Version :9

Sequence 1:NP_525031.1 Gene:Cyp4g1 / 30986 FlyBaseID:FBgn0010019 Length:556 Species:Drosophila melanogaster
Sequence 2:NP_176713.1 Gene:CYP96A3 / 842842 AraportID:AT1G65340 Length:503 Species:Arabidopsis thaliana


Alignment Length:488 Identity:106/488 - (21%)
Similarity:193/488 - (39%) Gaps:97/488 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly    99 LGNVLLVFLTNPSDIELILSGH-QHLTKAEEYRYFKPWFGDGLLISNGHHWRHHRKMIAPTF-HQ 161
            |..:.::...:|.:|..|||.: .:..|..|::......||.:...:...|...|......| :|
plant    75 LSGMDILLTVDPVNIHYILSSNFANYPKGMEFKKIFEVVGDSIFNVDSGLWEDMRNSSHAIFSNQ 139

  Fly   162 SILKSFVPTFVDHSKAVVARMGL------EAGKSF--DVHDYMSQTTVD--ILLSTAMGVKKLPE 216
            .....:|.|.|..     .|.||      .|.|:.  |:.|...:...|  ::|.|....|.|..
plant   140 DFQMFWVSTSVRK-----LRQGLVPILENAADKNILVDLQDLFQRFLFDTSLILMTGYDPKCLSV 199

  Fly   217 GNKSFEYAQAVVDMCDIIHKRQVK--LLYRLDSIYKFTKLREKGDRMMNIILGMTSKVVKDRKEN 279
            .....|:..||..:.|.:..|.||  .|:||..:.. ..:.::..|.:.:...:..|::..::|.
plant   200 EMPKVEFGDAVDGVSDGVFYRHVKPVFLWRLQYLIG-VGVEKRLKRGLAVFDQLLEKIITAKREE 263

  Fly   280 FQEE-----SRAIVEEISTPVASTPASKKEGLRDDLDDIDENDVGAKRRLALLDAMVEMAKNPDI 339
            ....     ||....::.|...:...:|.:.|...                              
plant   264 INSHGTHHPSRGEAIDVLTYYMTMDTTKYKYLEPS------------------------------ 298

  Fly   340 EWNEKDIMDEVNTIMFEGHDTTSAGSSFALCMMGIHKDIQAKVFAEQKAIFGDNMLRDCTF--AD 402
              :::.|.|.:...:....||||:..::...:|..:.:...|:..|    ....|.|   |  ||
plant   299 --DDRFIKDTILGFLIAARDTTSSALTWFFWLMSKNPEAINKIRQE----VNKKMPR---FDPAD 354

  Fly   403 TMEMKYLERVILETLRLYPPVPLIARRLDYDLKLASGPYTVPKGTTV------IVLQYCVHRRPD 461
            ..::.||...:.||||||||||       ::.|..:.|..:|.|..|      ::..|.:.|...
plant   355 LEKLVYLHGAVCETLRLYPPVP-------FNHKSPAKPDVLPSGHRVDEKWKIVISMYALGRMKS 412

  Fly   462 IYPNPTKFDPDNFLPE-------RMANRHYYSFIPFSAGPRSCVGRKYAMLKLKVLLSTIVRNY- 518
            ::.:    |.::|.||       |:.:...|.|:.|:||||:|:|:|...|::|.:.:.|:||| 
plant   413 VWGD----DAEDFRPERWISDSGRLKHEPSYKFLAFNAGPRACLGKKLTFLQMKTVAAEIIRNYD 473

  Fly   519 --IVHSTDTEADFKLQADIILKLENGFNVSLEK 549
              :|....||.    ...::.::::|..|::.:
plant   474 IKVVEGHKTEP----VPSVLFRMQHGLKVNITR 502

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cyp4g1NP_525031.1 p450 58..518 CDD:278495 99/452 (22%)
CYP96A3NP_176713.1 p450 22..502 CDD:386267 106/486 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 1 1.000 151 1.000 Domainoid score I1385
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1247045at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 1 1.000 - - mtm8393
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X23
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
44.010

Return to query results.
Submit another query.