DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cyp4g1 and CYP86A7

DIOPT Version :9

Sequence 1:NP_525031.1 Gene:Cyp4g1 / 30986 FlyBaseID:FBgn0010019 Length:556 Species:Drosophila melanogaster
Sequence 2:NP_176558.1 Gene:CYP86A7 / 842675 AraportID:AT1G63710 Length:523 Species:Arabidopsis thaliana


Alignment Length:484 Identity:108/484 - (22%)
Similarity:195/484 - (40%) Gaps:104/484 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly   109 NPSDIELILSGHQHLTKAEEYRYFKPW-------FGDGLLISNGHHWRHHRKMIAPTFHQSILKS 166
            :|.::|.||.     |:.:.|.....|       .|||:..|:|..||..||..|..|....|:.
plant    86 DPKNLEHILK-----TRFDNYPKGPSWQSVFHDLLGDGIFNSDGDTWRFQRKTAALEFTTRTLRQ 145

  Fly   167 FVPTFVDHSKAVVARMG--LEAGKS----FDVHDYMSQTTVDILLSTAMG------VKKLPEGNK 219
            .:..:||  :|:..|:.  ||:.:|    .|:.|.:.:.|.|.:.....|      ..:.||...
plant   146 AMARWVD--RAIKNRLVPILESARSRAEPIDLQDVLLRLTFDNICGLTFGKDPRTLSPEFPENGF 208

  Fly   220 SFEYAQAVVDMCDIIHKRQVKLLYRLDSIYKFTK-----LREKGDRMMNIILGMTSKVVKDRKEN 279
            :..:..|.        :..::.....:.|:|..|     |.:...|.::.:....|:::..||..
plant   209 AVAFDGAT--------EATLQRFIMPEFIWKIRKWLRLGLEDDMSRSISHVDNYLSEIINTRKLE 265

  Fly   280 F----QEESRAIVEEISTPVASTPASKKEGLRDDLDDIDENDVGAKRRLALLDAMVEMAKNPDIE 340
            .    |:|||                     .|||                   :....|..: .
plant   266 LLGQQQDESR---------------------HDDL-------------------LSRFMKKKE-S 289

  Fly   341 WNEKDIMDEVNTIMFEGHDTTSAGSSFALCMMGIHKDIQAKVFAEQKAI-----------FGDNM 394
            :::|.:.......:..|.||:|...|:...::.::..::.|:..|...|           :.|..
plant   290 YSDKYLKYVALNFILAGRDTSSVAMSWFFWLVSLNPRVEEKIINEICTILIKTRDTNVSKWTDEP 354

  Fly   395 LRDCTFADTMEMKYLERVILETLRLYPPVPLIARRLDYDLKLASGPYTVPKGTTVIVLQYCVHRR 459
            |   ||.:..::.||:..:.|||||||.||..::.:..:..|..|.: ||.|:.|....|.|.|.
plant   355 L---TFDEIDQLVYLKAALSETLRLYPSVPEDSKFVVANDVLPDGTF-VPSGSNVTYSIYSVGRM 415

  Fly   460 PDIY-PNPTKFDPDNFLPE-RMANRHYYSFIPFSAGPRSCVGRKYAMLKLK-VLLSTIVRNYIVH 521
            ..|: .:..:|.|:.:|.| |....:.|.|:.|:||||.|:|:..|.|::| :..|.::|:.:..
plant   416 KFIWGEDCLEFKPERWLEESRDEKCNQYKFVAFNAGPRICLGKDLAYLQMKSITASILLRHRLTV 480

  Fly   522 STDTEADFKLQADIILKLENGFNVSLEKR 550
            :.....:.|:...:.:|.  |..:.:.||
plant   481 APGHRVEQKMSLTLFMKF--GLKMDVHKR 507

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cyp4g1NP_525031.1 p450 58..518 CDD:278495 103/450 (23%)
CYP86A7NP_176558.1 PLN03195 4..507 CDD:215627 106/482 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 1 1.000 151 1.000 Domainoid score I1385
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1247045at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 1 1.000 - - mtm8393
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X23
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
44.010

Return to query results.
Submit another query.