DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cyp4g1 and CYP96A8

DIOPT Version :9

Sequence 1:NP_525031.1 Gene:Cyp4g1 / 30986 FlyBaseID:FBgn0010019 Length:556 Species:Drosophila melanogaster
Sequence 2:NP_175193.1 Gene:CYP96A8 / 841171 AraportID:AT1G47620 Length:520 Species:Arabidopsis thaliana


Alignment Length:489 Identity:107/489 - (21%)
Similarity:203/489 - (41%) Gaps:90/489 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly    98 WLGNVLLVFLTNPSDIELILSGH-QHLTKAEEYRYFKPWFGDGLLISNGHHWRHHRKMIAPTFHQ 161
            |...:.::...:|::|..|:|.: .:..|...:......||||::.::...||..|......|:.
plant    81 WFVGMDVLATVDPANIHHIMSSNFSNYIKGPIFHEIFEAFGDGIINTDAELWRDWRNASQLIFNH 145

  Fly   162 SILKSF-------------VPTFVDH--SKAVVARMGLEAGKSFDVHDYMSQTTVDILLSTAMGV 211
            ...::|             ||.| :|  ::.:|.          |:.|...:...||......|.
plant   146 QRYQNFSASTTKTKVNDGLVPLF-NHFANEEIVV----------DLEDVFQRFMYDITFIFITGT 199

  Fly   212 K------KLPEGNKSFEYAQAVVDMCDIIHKRQVKLLYRLDSIYKFTKLREKGDRMMNIILGMTS 270
            .      ::||    .|:::|:.|:.|.|..|.:...:    ::|..|.         |.:|...
plant   200 DPRSLSIEMPE----VEFSKALDDVGDAIVHRHITPRF----VWKLQKW---------IGIGTEK 247

  Fly   271 KVVKDRKENFQEESRAIVEEISTPVASTPASKKEGLRDDLDDIDENDVGAKRRLAL----LDAMV 331
            |::|         :.|..:.:...:.   |:|:|.|..  ..|..|..|.:..|..    |||..
plant   248 KMLK---------AHATFDRVCEKII---AAKREELGS--QGITYNSNGEREDLLTSFIKLDATK 298

  Fly   332 EMAKNPDIEWNEKDIMDEVNTIMFEGHDTTSAGSSFALCMMGIHKDIQAKVFAEQKAIFGDNMLR 396
            .....|.   ::|.:.|.....|..|.|:|::..::....:..:.::..|:..|    ...|:.|
plant   299 YEVLKPS---HDKFLRDFTIGFMAAGRDSTASTLTWFFWNLSKNPNVLTKILQE----INTNLPR 356

  Fly   397 DCTFADTM----EMKYLERVILETLRLYPPVPLIARRLDYDLKLASGPYTVPKGTTVIVLQYCVH 457
            ..:..|..    ::.||...:.|::|||||:|...:....:..|.|| :.|.....:::..|.:.
plant   357 TGSDQDMSSYLNKLVYLHGALSESMRLYPPIPFQRKSPIKEDVLPSG-HKVKSNINIMIFIYAMG 420

  Fly   458 RRPDIY-PNPTKFDPDNFLPERMANRH--YYSFIPFSAGPRSCVGRKYAMLKLKVLLSTIVRNY- 518
            |...|: .:..:|.|:.::.|....||  .|.|:.|:||||:|:|:..||..:|.::..|::|| 
plant   421 RMKTIWGEDAMEFKPERWISETGGVRHEPSYKFLSFNAGPRTCLGKNLAMNLMKTVIVEILQNYE 485

  Fly   519 --IVHSTDTEADFKLQADIILKLENGFNVSLEKR 550
              ||.....|.    :..:||.:::|..|::.|:
plant   486 IKIVSGQKIEP----KPGLILHMKHGLKVTMTKK 515

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cyp4g1NP_525031.1 p450 58..518 CDD:278495 97/452 (21%)
CYP96A8NP_175193.1 p450 1..515 CDD:386267 106/487 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 1 1.000 151 1.000 Domainoid score I1385
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1247045at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 1 1.000 - - mtm8393
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X23
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
44.010

Return to query results.
Submit another query.