DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cyp4g1 and CYP96A4

DIOPT Version :9

Sequence 1:NP_525031.1 Gene:Cyp4g1 / 30986 FlyBaseID:FBgn0010019 Length:556 Species:Drosophila melanogaster
Sequence 2:NP_200045.1 Gene:CYP96A4 / 835308 AraportID:AT5G52320 Length:502 Species:Arabidopsis thaliana


Alignment Length:487 Identity:103/487 - (21%)
Similarity:200/487 - (41%) Gaps:76/487 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly    89 NKYGETMKAWLGNVLLVFLTNPSDIELILSGH-QHLTKAEEYRYFKPWFGDGLLISNGHHWRHHR 152
            |..|..:..||....::...:|.:|:.|||.: .:..|.:::.....:.|||:...:...|...|
plant    65 NMTGCFIGPWLSGTDILLTVDPVNIQYILSSNFVNYPKGKKFNKIFEFLGDGIFNVDSGLWEDMR 129

  Fly   153 KMIAPTF-HQSILKSFVPTFVDH-SKAVVARM--GLEAGKSFDVHDYMSQTTVDILLSTAMGV-- 211
            ......| ||......|.|.|.. |:.:|..:  .:|.....|:.|...:...|...:...|.  
plant   130 NSSHAIFSHQDFQSFSVSTSVSKLSQGLVPILDNAVEKHILVDLQDLFQRFLFDTSSTLMAGYDP 194

  Fly   212 KKLPEGNKSFEYAQAVVDMCDIIHKRQVK--LLYRLDSIYKFTKLREKGDRMMNIILGMTSKVVK 274
            |.|.......|:|.|:..:.|.:..|.:|  .|:.:.| :....:.:|..|.:::...|..|::.
plant   195 KSLSVEMPKVEFADAMDGVADAMFYRHLKPAFLWSIQS-WIGVGIEKKMRRGLDVFDQMLGKIIS 258

  Fly   275 DRKENFQ----EESRAIVEEISTPVASTPASKKEGLRDDLDDIDENDVGAKRRLALLDAMVEMAK 335
            .::|..:    .:|:....::.|...:...:|.:.|:..                          
plant   259 AKREEIKNHGIHDSKGEAMDVLTYYMTIDTTKYKHLKPS-------------------------- 297

  Fly   336 NPDIEWNEKDIMDEVNTIMFEGHDTTSAGSSFALCMMGIHKDIQAKVFAEQKAIFGDNMLRDCTF 400
                  |:|.|.|.:..::....||||:..::...::..:.:...|:..|.     :..:.....
plant   298 ------NDKFIRDTILGLVIAARDTTSSALTWFFWLLSKNPEAMTKIRQEI-----NKKMPKFDP 351

  Fly   401 ADTMEMKYLERVILETLRLYPPVPLIARRLDYDLKLASGPYTVPKG------TTVIVLQYCVHRR 459
            ||..::.||:..:.|||||||.||       ::.|..:.|..:|.|      ..|::..|.:.|.
plant   352 ADLDKLVYLDGAVCETLRLYPSVP-------FNHKSPAKPDVLPSGHKVDKNWRVVIPIYSLGRM 409

  Fly   460 PDIYPNPTKFDPDNFLPER-------MANRHYYSFIPFSAGPRSCVGRKYAMLKLKVLLSTIVRN 517
            ..::.:    |.::|.|||       :.....|.|:.|:||||:|:|::...|::|.:...|:||
plant   410 KSVWGD----DAEDFRPERWISDSGMLRQESSYKFLAFNAGPRTCLGKRLTFLQMKTVAVEIIRN 470

  Fly   518 YIVHSTDTEADFKLQADIILKLENGFNVSLEK 549
            |.:...:.... |....::|::::|..||:.|
plant   471 YDIKVVEGHKP-KPVPSVLLRMQHGLKVSVTK 501

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cyp4g1NP_525031.1 p450 58..518 CDD:278495 95/454 (21%)
CYP96A4NP_200045.1 p450 1..501 CDD:416425 102/485 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 1 1.000 151 1.000 Domainoid score I1385
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1247045at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 1 1.000 - - mtm8393
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X23
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
55.010

Return to query results.
Submit another query.