DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cyp4g1 and AT5G51900

DIOPT Version :9

Sequence 1:NP_525031.1 Gene:Cyp4g1 / 30986 FlyBaseID:FBgn0010019 Length:556 Species:Drosophila melanogaster
Sequence 2:NP_200003.1 Gene:AT5G51900 / 835265 AraportID:AT5G51900 Length:242 Species:Arabidopsis thaliana


Alignment Length:325 Identity:62/325 - (19%)
Similarity:116/325 - (35%) Gaps:108/325 - (33%)


- Green bases have known domain annotations that are detailed below.


  Fly   248 IYKFTKLREKGDRMMNIILGMTSKVVKDRKENFQEESRAIVEEISTPVASTPASKKEGLRDDLDD 312
            :|:..|.|........|.:||..|::         |:.||.:.:.....|  |.::|..|..:::
plant     1 MYRHVKPRFSWKLQSWIGVGMEKKMI---------EAGAIFDRVCGKYIS--ARREEVKRSQVNN 54

  Fly   313 IDE--NDVGAK----------RRLALLDAMVEMAKNPDIEWNEKDIMDEVNTIMFEGHDTTSAGS 365
            .|.  .|..|.          .:..|||.:           |:|.:.|.|..::..|.|||::..
plant    55 NDHFIRDSHANLLTSHIKLDTTQYQLLDPI-----------NDKFLRDNVFALLLAGRDTTASAL 108

  Fly   366 SFALCMMGIHKDIQAKVFAEQKAIFGDNMLRDCT-----FADTMEMKYLER-----VILETLRLY 420
            ::....:..:..:..|:..|    ...|:.|.|:     ..|.||  ||.:     :....:|:.
plant   109 TWFFWFLSENPLVVTKIRQE----IDMNLPRSCSGQERPSCDPME--YLNKDDESCMGRRCIRIQ 167

  Fly   421 PPVPLIARRLDYDLKLASGPYTVPKGTTVIVLQYCVHRRPDIYPNPTKFDPDNFLPERMANRHYY 485
                  ||.:|:.                       .||                          
plant   168 ------AREMDFR-----------------------DRR-------------------------- 177

  Fly   486 SFIPFSAGPRSCVGRKYAMLKLKVLLSTIVRNYIVHSTDTEADFKLQADIILKLENGFNVSLEKR 550
              :......|.|.|::.||:::|::...|::||.:...:.: .|:....:|||:::||.|.:.||
plant   178 --VSIQCRSRICHGKQRAMVQMKIVAVEILQNYDIKVANGQ-KFEPDTSLILKMKHGFKVKINKR 239

  Fly   551  550
            plant   240  239

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cyp4g1NP_525031.1 p450 58..518 CDD:278495 51/291 (18%)
AT5G51900NP_200003.1 p450 <2..239 CDD:299894 60/322 (19%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1247045at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.