DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cyp4g1 and CYP714A2

DIOPT Version :9

Sequence 1:NP_525031.1 Gene:Cyp4g1 / 30986 FlyBaseID:FBgn0010019 Length:556 Species:Drosophila melanogaster
Sequence 2:NP_197872.1 Gene:CYP714A2 / 832559 AraportID:AT5G24900 Length:525 Species:Arabidopsis thaliana


Alignment Length:530 Identity:130/530 - (24%)
Similarity:222/530 - (41%) Gaps:114/530 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly    39 ALYEYWRRNSREYRMVANIPSPPELPILGQAHV---------AAGLSNAEILAVGLG-------- 86
            |:.|.||  .|....:..:..||  |.:...:|         |...|...|::....        
plant    31 AVVEQWR--MRRSLKLQGVKGPP--PSIFNGNVSEMQRIQSEAKHCSGDNIISHDYSSSLFPHFD 91

  Fly    87 -YLNKYGETMKAWLGNVLLVFLTNPSDIE-------LILSGHQHLTKAEEYRYFKPWFGDGLLIS 143
             :..:||.......|....:::.:|..::       |.|....|:||.     ..|..|:|::.|
plant    92 HWRKQYGRIYTYSTGLKQHLYINHPEMVKELSQTNTLNLGRITHITKR-----LNPILGNGIITS 151

  Fly   144 NGHHWRHHRKMIAPTFHQSILKSFVPTFVDHSKAV------VARMGLEAGKSFDVHDYMSQTTVD 202
            ||.||.|.|::||..|....:|..|...|:.:..:      :.:.|.|.|....|.:.:...:.|
plant   152 NGPHWAHQRRIIAYEFTHDKIKGMVGLMVESAMPMLNKWEEMVKRGGEMGCDIRVDEDLKDVSAD 216

  Fly   203 ILLSTAMGVKKLPEGNKSFEYAQAVV----DMCDIIHKRQVKLLYRLDSIYKFTKLREKGDRMMN 263
            ::.....|        .||...:|:.    |:...|.||.|        :::|.           
plant   217 VIAKACFG--------SSFSKGKAIFSMIRDLLTAITKRSV--------LFRFN----------- 254

  Fly   264 IILGMTSKVVKDRKENFQEESRAIVEEISTPVASTPASKKEGLRDDLDDIDENDVGAKRRLALLD 328
               |.|..|...:|.. ..:..|:..|:.:.:..|...::    .:..|..:.|:   .:|.|..
plant   255 ---GFTDMVFGSKKHG-DVDIDALEMELESSIWETVKERE----IECKDTHKKDL---MQLILEG 308

  Fly   329 AMVEMAKNPDIEWNE----KDIMDEVNTIMFEGHDTTSAGSSFALCMMGIHKDIQAKVFAEQKAI 389
            ||.....|   .|::    :.::|...:|.|.|||:|:...|:.|.::.::...|.|:       
plant   309 AMRSCDGN---LWDKSAYRRFVVDNCKSIYFAGHDSTAVSVSWCLMLLALNPSWQVKI------- 363

  Fly   390 FGDNMLRDC----TFADTM-EMKYLERVILETLRLYPPVPLIARRLDYDLKLASGPYTVPKGTTV 449
             .|.:|..|    ..|::: .:|.:..||.||:|||||.|::.|....|::|  |...||||..:
plant   364 -RDEILSSCKNGIPDAESIPNLKTVTMVIQETMRLYPPAPIVGREASKDIRL--GDLVVPKGVCI 425

  Fly   450 IVLQYCVHRRPDIYPNPTKFDPDNFLPERM------ANRHYYSFIPFSAGPRSCVGRKYAMLKLK 508
            ..|...:||.|:|: .|   |.::|.|||.      |.::..|:|||..|||:|||:.:.|:::|
plant   426 WTLIPALHRDPEIW-GP---DANDFKPERFSEGISKACKYPQSYIPFGLGPRTCVGKNFGMMEVK 486

  Fly   509 VLLSTIVRNY 518
            ||:|.||..:
plant   487 VLVSLIVSKF 496

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cyp4g1NP_525031.1 p450 58..518 CDD:278495 125/509 (25%)
CYP714A2NP_197872.1 p450 37..524 CDD:299894 127/524 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 170 1.000 Inparanoid score I1543
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000016
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X23
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
43.960

Return to query results.
Submit another query.