DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cyp4g1 and CYP96A13

DIOPT Version :9

Sequence 1:NP_525031.1 Gene:Cyp4g1 / 30986 FlyBaseID:FBgn0010019 Length:556 Species:Drosophila melanogaster
Sequence 2:NP_195910.1 Gene:CYP96A13 / 831752 AraportID:AT5G02900 Length:480 Species:Arabidopsis thaliana


Alignment Length:480 Identity:110/480 - (22%)
Similarity:204/480 - (42%) Gaps:90/480 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly    98 WLGNVLLVFLTNPSDIELILSGH-QHLTKAEEYRYFKPWFGDGLLISNGHH-WRHHRK-MIAPTF 159
            |...:.::|..:|::|..|:|.: .:.||..:::.....||||:|.::... |::.:| .:....
plant    63 WFTGMDMLFTVDPTNIHHIMSSNFSNYTKGPDFKQVFDVFGDGILTTDDSELWKNLKKASLVMLN 127

  Fly   160 HQSILKSFVPTFVDHSKAVVARMGLEAGKSFDVHDYMSQTTVDILLSTAMGVK-------KLPEG 217
            ||...|:                    |...|:.|...:...|..|.|..|..       ::|| 
plant   128 HQGFQKN--------------------GTVVDLQDVFKRFMFDTTLVTVTGSADPRSLSIEMPE- 171

  Fly   218 NKSFEYAQAVVDMCDIIHKRQV--KLLYRLDSIYKF--TKLREKGDRMMNIILGMTSKVVKDRKE 278
               .|:|:|:..:.:.|..|.|  :||::|.....|  .|...|.|..:|               
plant   172 ---VEFAKALDHVGEGIMHRHVRPRLLWKLQKCVGFGQEKKFSKADATLN--------------- 218

  Fly   279 NFQEESRAIVEEISTPVASTPASKKEGLRDDLDDIDENDVGAKRRLAL---LDAMVEMAKNPDIE 340
              |..::.|:|            |:|..|....|...|...::..|..   :|.......||.  
plant   219 --QACAKYILE------------KREETRSQGFDYHSNGSESEDILTYHIKIDTTKYELLNPS-- 267

  Fly   341 WNEKDIMDEVNTIMFEGHDTTSAGSSFALCMMGIHKDIQAKVFAEQKAIFGDNMLRDCTFADTME 405
             ::|.:.|.:...:..|.|||::..::...::..:..:..|:..|.....|......|   :.||
plant   268 -DDKFLRDTILAFVLAGRDTTASALTWFFWLLLENPQVVTKIRQEINTSNGGQEKPSC---EPME 328

  Fly   406 ----MKYLERVILETLRLYPPVPLIARRLDYDLK---LASGPYTVPKGTTVIVLQYCVHRRPDIY 463
                :.||...:.|.:|||||||.  .|:. .:|   |.|| :.|.....:::..|.:.|...::
plant   329 YLNNLVYLHGALYEAMRLYPPVPF--ERMS-PIKPDVLPSG-HKVDSSMKILIFIYALGRMRAVW 389

  Fly   464 -PNPTKFDPDNFLPERMANRH--YYSFIPFSAGPRSCVGRKYAMLKLKVLLSTIVRNYIVHSTDT 525
             .:.::|.|:.:|.|..:.||  .:.|:.|:||||||:|::.||..:|:::..|::||.:.....
plant   390 GEDASEFKPERWLSETTSLRHEPSFKFLAFNAGPRSCIGKQLAMTLMKIVVVEILQNYDIKVVKG 454

  Fly   526 EADFKLQADIILKLENGFNVSLEKR 550
            :...:.....||::::|..|:|.|:
plant   455 QKKIEPAPGPILRMKHGLRVTLTKK 479

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cyp4g1NP_525031.1 p450 58..518 CDD:278495 102/446 (23%)
CYP96A13NP_195910.1 p450 1..479 CDD:299894 109/478 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 1 1.000 151 1.000 Domainoid score I1385
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1247045at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 1 1.000 - - mtm8393
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X23
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
44.010

Return to query results.
Submit another query.