DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cyp4g1 and CYP96A2

DIOPT Version :9

Sequence 1:NP_525031.1 Gene:Cyp4g1 / 30986 FlyBaseID:FBgn0010019 Length:556 Species:Drosophila melanogaster
Sequence 2:NP_194944.1 Gene:CYP96A2 / 829349 AraportID:AT4G32170 Length:506 Species:Arabidopsis thaliana


Alignment Length:483 Identity:102/483 - (21%)
Similarity:198/483 - (40%) Gaps:93/483 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly   104 LVFLTNPSDIELILSGH-QHLTKAEEYRYFKPWFGDGLLISNGHHWRHHRKMIAPTFHQSILKSF 167
            ::...:|::|..|:|.: .:..|..|::......||..:.::...|::.||......|....:.|
plant    78 MLLTVDPANIHHIMSSNFSNYIKGPEFQDVFDVLGDSFITTDSELWKNMRKSYQAMLHSQEFQRF 142

  Fly   168 -VPTFVDHSKAVVARMGL--------EAGKSFDVHDYMSQTTVDILLSTAMGVK------KLPEG 217
             :.|.....|     .||        |.|.:.|:.....:.|.|.:.....|..      ::||.
plant   143 SMSTMTSKLK-----YGLVPLLNHFAEEGTTLDLQSVFGRFTFDTIFILVTGSDPRSLSIEMPED 202

  Fly   218 NKSFEYAQAVVDMCDIIHKRQVK--LLYRLDSIYKF---TKLREKG---DRMMNIILGMTSKVVK 274
                |:|:|:.|:.:.|..|..|  .|::|.:...|   .||.|..   ||       :.:|.:.
plant   203 ----EFAKALDDVGEGILYRHFKPRFLWKLQNWIGFGQEKKLTEANATFDR-------VCAKYIS 256

  Fly   275 DRKENFQEESRAIVEEISTPVASTPASKKEGLRDDLDDIDENDVGAKRRLALLDAMVEMAKNPDI 339
            .::|.               :..:..:...|.:|.|....:.|....:.|           ||. 
plant   257 AKREE---------------IKRSQGTSNGGSQDLLTSFIKLDTTKYKLL-----------NPS- 294

  Fly   340 EWNEKDIMDEVNTIMFEGHDTTSAGSSFALCMMGIHKDIQAKVFAEQKAIFGDNMLRDCTFADTM 404
              ::|.:.|.:...:..|.|||:...|:...::..:..:.||:  .|:.....::.|.....:.:
plant   295 --DDKFLRDNILAFILAGRDTTATALSWFFWLLSENPHVVAKI--HQEININTDLSRTGNSQENV 355

  Fly   405 E-MKYLERVILETLRLYPPVPLIARRLDYDLKLASGPYTVPKGTTVIVLQYCVHRRPDIY-PNPT 467
            : :.||...:.|.:||||||. ..|:......:....:.|...:.:|:..|.:.|...:: .:.:
plant   356 DKLVYLHGALCEAMRLYPPVS-FGRKSPIKSDVLPSGHKVDANSKIIICLYALGRMRAVWGEDAS 419

  Fly   468 KFDPDNFLPERMANRH--YYSFIPFSAGPRSCVGRKYAMLKLKVLLSTIVRNYIVHSTDTEADFK 530
            :|.|:.::.|....:|  .:.|:.|:||||:|:|:..||.::|::...|:|||         |.|
plant   420 QFKPERWISENGGIKHEPSFKFLSFNAGPRTCLGKHLAMTQMKIVAVEILRNY---------DIK 475

  Fly   531 -LQAD-------IILKLENGFNVSLEKR 550
             ||..       .||.:::|..:::.||
plant   476 VLQGQKIVPALGFILSMKHGLQITVTKR 503

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cyp4g1NP_525031.1 p450 58..518 CDD:278495 91/441 (21%)
CYP96A2NP_194944.1 p450 1..503 CDD:416425 100/481 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 1 1.000 151 1.000 Domainoid score I1385
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1247045at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 1 1.000 - - mtm8393
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X23
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
44.010

Return to query results.
Submit another query.