DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cyp4g1 and CYP709B3

DIOPT Version :9

Sequence 1:NP_525031.1 Gene:Cyp4g1 / 30986 FlyBaseID:FBgn0010019 Length:556 Species:Drosophila melanogaster
Sequence 2:NP_194501.1 Gene:CYP709B3 / 828885 AraportID:AT4G27710 Length:518 Species:Arabidopsis thaliana


Alignment Length:459 Identity:112/459 - (24%)
Similarity:195/459 - (42%) Gaps:89/459 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly    87 YLNKYGETMKAWLGNVLLVFLTNPSDIELILSGHQHLT----KAEEYRYFKPWFGDGLLISNGHH 147
            ::::||:|...|.|....::::|....:.:||.....|    |..|....   ||.||....|..
plant    90 WMSQYGDTFLFWTGTKPTIYISNHELAKQVLSSKFGFTIIPVKRPEVFIL---FGKGLSFIQGDD 151

  Fly   148 WRHHRKMIAPTFHQSILKSFVPTFVDHSKAVV------ARMG-----LEAGKSFDVHDYMSQTTV 201
            |..||:::.|.|....||:......|.:..:.      .|.|     :|..|.|      .:.|.
plant   152 WIRHRRILNPAFSMDRLKAMTQPMGDCTLRIFEEWRKQRRNGEVLIKIEISKEF------HKLTA 210

  Fly   202 DILLSTAMGVKKLPEGNKSFEYAQAVVDMCDIIHKRQVKL-LYRLDSIYKFTKLREKGDRMMNII 265
            ||:.:||.|          ..||:. :::|    :.|.:| .|.:.|             :.|:.
plant   211 DIIATTAFG----------SSYAEG-IELC----RSQTELEKYYISS-------------LTNVF 247

  Fly   266 LGMTSKVVKDRKENFQEESRAIVEEISTPVASTPASKKE--GLRDDLDDIDENDVGAKRRLALLD 328
            :..|..:.........|..:.:...|...:.|...||.:  |..||                ||.
plant   248 IPGTQYLPTPTNLKLWELHKKVKNSIKRIIDSRLKSKCKTYGYGDD----------------LLG 296

  Fly   329 AMVEMAKNPDIEWNEK--DIMDEVNTIMFEGHDTTSAGSSFALCMMGIHKDIQAKVFAEQKAIFG 391
            .|:..||:.:.|...:  :|::|.....:.|..|||...::...::.:|:..|.|:..|.....|
plant   297 VMLTAAKSNEYERKMRMDEIIEECKNFYYAGQGTTSILLTWTTMLLSLHQGWQEKLREEVFNECG 361

  Fly   392 DNMLRDC-TFADTMEMKYLERVILETLRLYPPVPLIARRLDYDLKLASGPYTVPKGTTVIVLQYC 455
            .:.:.|. ||:   ::|.:..|::|:||||.||..|:|....|:|:  |...:||||::|:....
plant   362 KDKIPDTDTFS---KLKLMNMVLMESLRLYGPVIKISREATQDMKV--GHLEIPKGTSIIIPLLK 421

  Fly   456 VHRRPDIYPNPTKFDPDNFLPERMANR------HYYSFIPFSAGPRSCVGRKYAMLKLKVLLSTI 514
            :||...|:..    |.:.|.|.|..|.      |..:.:|||.|||:|:.:.:||::.|.:|:.|
plant   422 MHRDKAIWGE----DAEQFNPLRFENGISQATIHPNALLPFSIGPRACIAKNFAMVEAKTVLTMI 482

  Fly   515 VRNY 518
            ::.:
plant   483 LQQF 486

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cyp4g1NP_525031.1 p450 58..518 CDD:278495 112/457 (25%)
CYP709B3NP_194501.1 p450 9..517 CDD:299894 112/459 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 170 1.000 Inparanoid score I1543
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000016
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X23
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
43.960

Return to query results.
Submit another query.