DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cyp4g1 and CYP94D2

DIOPT Version :9

Sequence 1:NP_525031.1 Gene:Cyp4g1 / 30986 FlyBaseID:FBgn0010019 Length:556 Species:Drosophila melanogaster
Sequence 2:NP_191222.1 Gene:CYP94D2 / 824830 AraportID:AT3G56630 Length:499 Species:Arabidopsis thaliana


Alignment Length:481 Identity:111/481 - (23%)
Similarity:201/481 - (41%) Gaps:84/481 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly   100 GNVLLVFLTNPSDIELILSGHQHLTKAEEY----RY---FKPWFGDGLLISNGHHWRHHRKMIAP 157
            |.:..|...||:::|.:|.     ||.|.:    |:   .:.:.|.|:..|:|..|...||..:.
plant    72 GKLQFVMTANPANVEYMLK-----TKFESFPKGERFISILEDFLGRGIFNSDGEMWWKQRKTASY 131

  Fly   158 TFHQSILKSFVPTFVD---HSKAV-VARMGLEAGKSFDVHDYMSQTTVDILLSTAMGVKKL---P 215
            .|....|:.||.:.|.   :::.| |.......||..|:.|.:.:...|.:...|..|...   .
plant   132 EFSTKSLRDFVMSNVTVEINTRLVPVLAEAATNGKLIDLQDILERFAFDNICKLAFNVDSACLGD 196

  Fly   216 EGNKSFEYAQAVVDMCDIIHKRQVKLLYRLDSIYKFT-KLREKGDRMMNIILGMTSKVVKDRKEN 279
            :|.....:.||......||.:       |..|:..:: |:::|    :||           ..|.
plant   197 DGAAGVNFMQAFETAATIISQ-------RFQSVISYSWKIKKK----LNI-----------GSER 239

  Fly   280 FQEESRAIVEEISTPVASTPASKKEGLRDDLDDIDENDVGAKRRLALLDAMV--EMAKNPDIEWN 342
            ...||..||.:.:..:......:.: :.|..:|             ||...:  |...:|:|   
plant   240 VLRESIMIVHKFADEIVRNRIEQGK-VSDHKED-------------LLSRFISKEEMNSPEI--- 287

  Fly   343 EKDIMDEVNTIMFEGHDTTSAGSSFALCMMGIHKDIQAKVFAEQKAIFGDNMLRDCT-------- 399
               :.|.|.:.:..|.||||:..|:...::.:|.:::.|:..|.      |.:|:.|        
plant   288 ---LRDIVISFILAGRDTTSSALSWFFWLLSMHPEVKDKILQEL------NSIRERTGKRIGEVY 343

  Fly   400 -FADTMEMKYLERVILETLRLYPPVPLIARRLDYDLKLASGPYTVPKGTTVIVLQYCVHRRPDIY 463
             |.|...|.||...|.|:||||||||:.......|..|..|.: :.|...:....|.:.|...|:
plant   344 GFEDLKLMNYLHAAITESLRLYPPVPVDTMSCAEDNVLPDGTF-IGKDWGISYNAYAMGRMESIW 407

  Fly   464 -PNPTKFDPDNFLPER---MANRHYYSFIPFSAGPRSCVGRKYAMLKLKVLLSTIVRNYIVHSTD 524
             .:..:|||:.::.|.   ....:.|.|..|.||||.|:|::.|.:::|.:::.::..::|....
plant   408 GKDCDRFDPERWIDETNGGFRGENPYKFPAFHAGPRMCLGKEMAYIQMKSIVAAVLERFVVEVPG 472

  Fly   525 TEADFKLQADIILKLENGFNVSLEKR 550
            .:...::...:.|::..|.||.:::|
plant   473 KKERPEILMSVTLRIRGGLNVRVQER 498

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cyp4g1NP_525031.1 p450 58..518 CDD:278495 105/447 (23%)
CYP94D2NP_191222.1 p450 52..499 CDD:299894 111/481 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 1 1.000 151 1.000 Domainoid score I1385
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1247045at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 1 1.000 - - mtm8393
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X23
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
44.010

Return to query results.
Submit another query.