DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cyp4g1 and CYP94B3

DIOPT Version :9

Sequence 1:NP_525031.1 Gene:Cyp4g1 / 30986 FlyBaseID:FBgn0010019 Length:556 Species:Drosophila melanogaster
Sequence 2:NP_190421.1 Gene:CYP94B3 / 824011 AraportID:AT3G48520 Length:506 Species:Arabidopsis thaliana


Alignment Length:550 Identity:116/550 - (21%)
Similarity:209/550 - (38%) Gaps:141/550 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly    60 PPELPILGQAHVAAGLSNAEILAVGLGYLNKYGETMKAW-----------------LGNVLLVFL 107
            ||..|::|           .||:     .||....:..|                 |||...:..
plant    36 PPSYPLIG-----------SILS-----FNKNRHRLLQWYTELLRLSPSQTILVPLLGNRRTIIT 84

  Fly   108 TNPSDIELILSGHQHLTKAEEYRYFKPW-------FGDGLLISNGHHWRHHRKMIAPTFHQSILK 165
            |||.::|.||.     |....:...||:       .|.|:...:||.|...||:.:..|....|:
plant    85 TNPLNVEYILK-----TNFFNFPKGKPFTDLLGDLLGGGIFNVDGHSWSSQRKLASHEFSTRSLR 144

  Fly   166 SF----VPTFVDHSKAVVARMGLEAGKSFDVHDYMSQTTVDILLSTAMG-----------VKKLP 215
            ||    :...|::....|.....:.|.:.|:.|.:.:...|::...::|           |..|.
plant   145 SFAFEVLKDEVENRLVPVLSTAADVGTTVDLQDVLKRFAFDVVCKVSLGWDPDCLDLTRPVNPLV 209

  Fly   216 EGNKSFEYAQAVVDMCDIIHKRQVKLLYRLDSIYKFTKLREKGDRMMNIILGMTSKVVKDRKENF 280
            |   :|:.|      .:|..:|..:.:|   :::| ||      |::|:  |...|:        
plant   210 E---AFDTA------AEISARRATEPIY---AVWK-TK------RVLNV--GSERKL-------- 245

  Fly   281 QEESRAIVEEISTPVASTPASKKEGLRDDLDDIDENDVGAKRRLALLDAMVEMAKNPDIEWNEKD 345
                |..:..:...|:....:||:.|        |...||:.:..||...:....|.:.      
plant   246 ----REAIRTVHVLVSEIVRAKKKSL--------EIGTGAEAKQDLLSRFLAAGHNGEA------ 292

  Fly   346 IMDEVNTIMFEGHDTTSAGSSFALCMMGIHKDIQAKVFAEQKAIFGDNMLRDCTFADTMEMKYLE 410
            :.|.|.:.:..|.|||||..::...::..:.|::.|:..|...:....:    .|.|..||.|.:
plant   293 VRDMVISFIMAGRDTTSAAMTWLFWLLTENDDVERKILEEVDPLVSLGL----GFEDLKEMAYTK 353

  Fly   411 RVILETLRLYPPVPLIARRLDYDLKLASGPYTVPKGT------TVIVLQYCVHRRPDIYPNPTKF 469
            ..:.|.:||||||       .:|.|.|:....:|.||      .|....|.:.|...::..    
plant   354 ACLCEAMRLYPPV-------SWDSKHAANDDVLPDGTRVKRGDKVTYFPYGMGRMETLWGT---- 407

  Fly   470 DPDNFLPERMANRH------------YYSFIPFSAGPRSCVGRKYAMLKLKVLLSTIVRNYIVHS 522
            |.:.|.|.|..:..            .|.|..|.||||.|||::.|.:::|.::.:::..:.:..
plant   408 DSEEFNPNRWFDSEPGSTRPVLKPISPYKFPVFQAGPRVCVGKEMAFMQMKYVVGSVLSRFEIVP 472

  Fly   523 TDTEADFKLQADIILKLENGFNVSLEKRQY 552
            .:.:....:.. :...:..|..|.:::|.:
plant   473 VNKDRPVFVPL-LTAHMAGGLKVKIKRRSH 501

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cyp4g1NP_525031.1 p450 58..518 CDD:278495 113/514 (22%)
CYP94B3NP_190421.1 p450 46..501 CDD:386267 111/527 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 1 1.000 151 1.000 Domainoid score I1385
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1247045at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 1 1.000 - - mtm8393
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X23
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
44.010

Return to query results.
Submit another query.