DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cyp4g1 and AT3G44970

DIOPT Version :9

Sequence 1:NP_525031.1 Gene:Cyp4g1 / 30986 FlyBaseID:FBgn0010019 Length:556 Species:Drosophila melanogaster
Sequence 2:NP_190083.2 Gene:AT3G44970 / 823632 AraportID:AT3G44970 Length:479 Species:Arabidopsis thaliana


Alignment Length:448 Identity:103/448 - (22%)
Similarity:178/448 - (39%) Gaps:88/448 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly   152 RKMI--APTFHQSILKSFVPTFVDHSKAVVARMGLEAGKSF----------------------DV 192
            :||:  .|.|..:||.  |.|.|...|.|...:..:..|||                      ::
plant    66 KKMLRYGPLFRTNILG--VKTVVSTDKDVNMEILRQENKSFILSYPDGLMKPLGKDSLFLKIGNI 128

  Fly   193 HDYMSQTTVDILLSTAMGVKKLPEGNKSFEYAQAVVDMCDIIHKRQVKLLYRLDSIYKFTKLREK 257
            |.::.|.|:.:|.|..:..|.|.:           :|.....|........|||.....:||   
plant   129 HKHIKQITLHLLSSEGLKRKILKD-----------MDRVTREHLSSKAKTGRLDVKDAVSKL--- 179

  Fly   258 GDRMMNIILGMTSKVVKDRKENFQEESRAIVEEISTPVAST----PASK---------KEGLRDD 309
                  ||..:|.|::.:.|...|.:...|.:..:.....|    .|.|         :||:|:.
plant   180 ------IIAHLTPKMMSNLKPQTQAKLMGIFKAFTFDWFRTSYLISAGKGLYNTLWACREGMREI 238

  Fly   310 LDDIDENDVGAKRRLALLDAMVEMAKNPDIEWNEKDIMDEVNTIMFEGHDTTSAGSSFALCMMGI 374
            .|.........::....|:..:|.::......||..|:..:.|:.....||||.....|:..:..
plant   239 KDIYTMRKTSEEKYDDFLNTAIEESEKAGELLNENAIITLIFTLSCVTQDTTSKAICLAVKFLLE 303

  Fly   375 HKDIQAKVFAEQKAIFGDNMLRDCTFADTME-----MKYLERVILETLRLYPPVPLIARRLDYDL 434
            :..:.|::..|.:.|....  .|.....|.|     |.:...||.|:||:....|::.|:...|:
plant   304 NPKVLAELKKEHEVILESR--EDKEGGVTWEEYRHKMTFTNMVINESLRITNLAPMLFRKAVKDV 366

  Fly   435 KLASGPYTVPKGTTVIVLQYCVHRRPDIYPNPTKFDPDNFLPE--RMANRHYYSFIPFSAGPRSC 497
            ::..  ||:|.|..|:::...||..|:||.||.:|:|..:..:  |..::   :|:.|..|.|.|
plant   367 EIKG--YTIPAGWIVMIIPSVVHFDPEIYENPFEFNPWRWEGKELRAGSK---TFMVFGTGLRQC 426

  Fly   498 VGRKYAMLKLKVLLSTIVRNYIVHSTDTEADFKLQADI-ILK-----LENGFNVSLEK 549
            .|.::|.|::.|.|..:|..|         :|.|..|. :|:     |.||.::::.|
plant   427 AGAEFARLQISVFLHHLVTTY---------NFSLHQDCEVLRVPAAHLPNGISINISK 475

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cyp4g1NP_525031.1 p450 58..518 CDD:278495 94/409 (23%)
AT3G44970NP_190083.2 p450 34..475 CDD:299894 102/446 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1247045at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.