DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cyp4g1 and CYP702A8

DIOPT Version :9

Sequence 1:NP_525031.1 Gene:Cyp4g1 / 30986 FlyBaseID:FBgn0010019 Length:556 Species:Drosophila melanogaster
Sequence 2:NP_189648.1 Gene:CYP702A8 / 822729 AraportID:AT3G30290 Length:408 Species:Arabidopsis thaliana


Alignment Length:469 Identity:103/469 - (21%)
Similarity:187/469 - (39%) Gaps:99/469 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly   100 GNVLLVFLTNPSDIELILSGH-QHLTKAEEYRYFKPWFGD--GLLISNGHHWRHHRKMIAPTFHQ 161
            |..:::.:.|..::|:..:.. ..:||:     ....||:  .|.:.:....:|.|.:.......
plant    11 GGKVIISMDNELNMEMAKTNRTPGITKS-----IARLFGEDNNLFLQSTESHKHVRNLTVQMLGS 70

  Fly   162 SILKSFVPTFVDHSKAVVARMGLEAGK---SFDVHDYMSQTTVDILLSTAMGVKKLPEGNKSFEY 223
            ..||..:...:|    ::.|..:|.|.   |.||.:..|:..::.|....||..: ||..|.   
plant    71 QSLKLRIMENID----LLTRTHMEEGARDGSLDVKETTSKILIECLAKKVMGEME-PEAAKK--- 127

  Fly   224 AQAVVDMC-DIIHKRQVKLLYRLDSI--YKFTKLREKGDRMMNIILGMTSKVVKDRK--ENFQEE 283
                :.:| ........:|.:.|..|  |...|.|:   ||..:   :..:|:|.|:  |.|.|.
plant   128 ----LALCWRYFPSGWFRLPFNLPGIGVYNMMKARK---RMKTL---LKEEVLKKREAGEEFGEF 182

  Fly   284 SRAIVEEISTPVASTPASKKEGLRDDLDDIDENDVGAKRRLALLDAMVEMAKNPDIEWNEKDIMD 348
            |:.|..|            |||.::.:                               :.|::::
plant   183 SKIIFGE------------KEGEKETM-------------------------------SMKNVIE 204

  Fly   349 EVNTIMFEGHDTTSAGSSFALCMMGIHKDIQAKVFAEQKAIFGDNMLRDC--TFADTMEMKYLER 411
            .:.|.....::||....:..:..:..:..:..::..|...|| :|...:.  |:.|...|.:...
plant   205 YIYTFFVIANETTPRILAATVKFISENPKVMQELQREHAMIF-ENKSEEAGLTWEDYKSMTFTNM 268

  Fly   412 VILETLRLYPPVPLIARRLDYDLKLASGPYTVPKGTTVIVLQYCVHRRPDIYPNPTKF-DPDNFL 475
            ||.|:||:...||:|.|:.|:|.|:  |.||:|.|..  .:.|     |..:.:|||: ||..|.
plant   269 VINESLRISTTVPVILRKPDHDTKV--GDYTIPAGWN--FMGY-----PSAHFDPTKYEDPLEFN 324

  Fly   476 PERMANRHY-----YSFIPFSAGPRSCVGRKYAMLKLKVLLSTIVRNYIVHSTDTEADFKLQADI 535
            |.|......     .::|||.||||.|||..:|    |:|::..:.:...:....:|:..:....
plant   325 PWRWKGNDLDAIVSTNYIPFGAGPRLCVGAYFA----KLLMAIFIHHLCRYRWSMKAEVTVTRSY 385

  Fly   536 ILKLENGFNVSLEK 549
            :|....|.:|.:.|
plant   386 MLMFPRGCDVQISK 399

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cyp4g1NP_525031.1 p450 58..518 CDD:278495 98/436 (22%)
CYP702A8NP_189648.1 p450 5..374 CDD:299894 98/442 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1247045at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.