DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cyp4g1 and CYP72A9

DIOPT Version :9

Sequence 1:NP_525031.1 Gene:Cyp4g1 / 30986 FlyBaseID:FBgn0010019 Length:556 Species:Drosophila melanogaster
Sequence 2:NP_188081.2 Gene:CYP72A9 / 820691 AraportID:AT3G14630 Length:563 Species:Arabidopsis thaliana


Alignment Length:522 Identity:131/522 - (25%)
Similarity:217/522 - (41%) Gaps:107/522 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly    29 TTLVGTLVAMALYEYWRRNSREYRMVANIPSPPELPILGQAHVAAGLSNAEILAVGLGY----LN 89
            |.|||.:            .|.:.|:....|.|..|            ..:::::.:.|    ||
plant   101 TPLVGDV------------RRSFSMLKEARSKPMKP------------TDDLISLVMPYSFHMLN 141

  Fly    90 KYGETMKAWLGNVLLVFLTNPSDIELILSGHQHLTKAEEYRYFKPWFGDGLLISNGHHWRHHRKM 154
            .||:|...|.|.:..:.:.||..|:.:.:......|...:. ......|||..::|..|..|||:
plant   142 TYGKTFFTWSGPIPAITIMNPQLIKEVYNKFYDFEKTHTFP-LTSLLTDGLANADGDKWVKHRKI 205

  Fly   155 IAPTFHQSILKSFVPTFVDHSKAVVA---RMGLEAGKS--FDVHDYMSQTTVDILLSTAMGVKKL 214
            |.|.||...:|:.||||......|:.   ::..:.|.|  .||..::...|.|::..||.| ...
plant   206 INPAFHFEKIKNMVPTFYKSCIEVMCEWEKLVSDKGSSCELDVWPWIVNMTGDVISRTAFG-SSY 269

  Fly   215 PEGNKSF----EYAQAVVDMCDIIHKRQVKLLYRLDSIYKFTKLREKGDRMMNIILGMTSKVVKD 275
            .||.:.|    |.|..::            |....:.|..:.....|.:|.|             
plant   270 KEGQRIFILQAELAHLII------------LALGKNYIPAYRHFPTKNNRRM------------- 309

  Fly   276 RKENFQEESRAIVEEISTPVASTPASKKEGLRDDLDDIDENDVGAKRRLALLDAMVEMAKNPDIE 340
                     :.||:||.. :.....|.:|..||..:...::.:|     .||.:..|.:|...: 
plant   310 ---------KTIVKEIQV-ILRGIISHREKARDAGEAPSDDLLG-----ILLKSNSEQSKGNGL- 358

  Fly   341 WNEKDIMDEVNTIMFEGHDTTSAGSSFALCMMGIHKDIQAKVFAEQKAIFGDNM--LRDCTFADT 403
             |.::||:|.....|.|.:|||...::.:.::..|:|.||:...|...:||.|.  |:...    
plant   359 -NMEEIMEECKLFYFAGQETTSVLLAWTMVLLSQHQDWQARAREEVMQVFGHNKPDLQGIN---- 418

  Fly   404 MEMKYLERVILETLRLYPPVPLIARRLDYDLKLASGPYTVPKGTTVIVLQYCVHRRPDIYPNPTK 468
             ::|.:..:|.|.|||||||..:.|....::||  |..|:|.|..|.:....:||...::.:   
plant   419 -QLKVMTMIIYEVLRLYPPVIQMNRATHKEIKL--GDMTLPGGIQVHMPVLLIHRDTKLWGD--- 477

  Fly   469 FDPDNFLPERM------ANRHYYSFIPFSAGPRSCVGRKYAMLKLKVLLSTIVRNY-------IV 520
             |...|.|||.      |.::...|:||..|||.|:|:.:|:|:.|:.|:.|::.:       .|
plant   478 -DAAEFKPERFKDGIAKATKNQVCFLPFGWGPRICIGQNFALLEAKMALALILQRFSFELSPSYV 541

  Fly   521 HS 522
            ||
plant   542 HS 543

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cyp4g1NP_525031.1 p450 58..518 CDD:278495 122/480 (25%)
CYP72A9NP_188081.2 p450 59..563 CDD:386267 131/522 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 170 1.000 Inparanoid score I1543
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000016
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X23
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
33.050

Return to query results.
Submit another query.