DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cyp4g1 and CYP704A1

DIOPT Version :9

Sequence 1:NP_525031.1 Gene:Cyp4g1 / 30986 FlyBaseID:FBgn0010019 Length:556 Species:Drosophila melanogaster
Sequence 2:NP_850427.2 Gene:CYP704A1 / 819098 AraportID:AT2G44890 Length:511 Species:Arabidopsis thaliana


Alignment Length:483 Identity:114/483 - (23%)
Similarity:199/483 - (41%) Gaps:102/483 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly   105 VFLTNPSDIELILSGHQHLTKAEEYRYFK---------PWFGDGLLISNGHHWRHHRKMIAPTFH 160
            :|..:|.::|       |:.|...:.|.|         ...|.|:...:|..|:..||:::..|.
plant    81 IFTADPRNVE-------HILKTRFHNYSKGPVGTVNLADLLGHGIFAVDGEKWKQQRKLVSFEFS 138

  Fly   161 QSILKSFVPTF--VDHSKAV--VARMGLEAGKSFDVHDYMSQTTVDILLSTAMGVKKLPEGNKSF 221
            ..:|::|..:.  ...||.|  :|...| :|||||..|.:.:.|:|.:.....||:         
plant   139 TRVLRNFSYSVFRTSASKLVGFIAEFAL-SGKSFDFQDMLMKCTLDSIFKVGFGVE--------- 193

  Fly   222 EYAQAVVDMCDIIHKRQVKLLYRLDSIYK----FTKLREKGDRMMNIILGMTSKVVKD------- 275
                                |..||...|    |.|..::|:       |.||..|.|       
plant   194 --------------------LGCLDGFSKEGEEFMKAFDEGN-------GATSSRVTDPFWKLKC 231

  Fly   276 ----RKENFQEESRAIVEEISTPVASTPASKKEGLRDDLDDIDENDVGAKRRLALLDAMVEMAKN 336
                ..|:..::|.||:::.   |.|...:|::.|..:.:.....|:.:|       .::|..|:
plant   232 FLNIGSESRLKKSIAIIDKF---VYSLITTKRKELSKEQNTSVREDILSK-------FLLESEKD 286

  Fly   337 PDIEWNEKDIMDEVNTIMFEGHDTTSAGSSFALCMMGIHKDIQAKVFAE--------QKAIFGDN 393
            |: ..|:|.:.|.:..:|..|.|||:|..|:.|.|:..:..:|.|:..|        :|....:.
plant   287 PE-NMNDKYLRDIILNVMVAGKDTTAASLSWFLYMLCKNPLVQEKIVQEIRDVTSSHEKTTDVNG 350

  Fly   394 MLRDCTFADTMEMKYLERVILETLRLYPPVPLIARRLDYDLKLASGPYTVPKGTTVIVLQYCVHR 458
            .:...|.....:|:||...:.||:|||||||...|..:.|..|..| :.|.||..:..:.|.:.|
plant   351 FIESVTEEALAQMQYLHAALSETMRLYPPVPEHMRCAENDDVLPDG-HRVSKGDNIYYISYAMGR 414

  Fly   459 RPDIYPNPTKFDPDNFLPERMAN------RHYYSFIPFSAGPRSCVGRKYAMLKLKVLLSTIVRN 517
            ...|:..    |.:.|.|||...      ...:.||.|.||||.|:|:.:|..::|::...::..
plant   415 MTYIWGQ----DAEEFKPERWLKDGVFQPESQFKFISFHAGPRICIGKDFAYRQMKIVSMALLHF 475

  Fly   518 YIVHSTDTEADFKLQADIILKLENGFNV 545
            :.....|..:....:..:.|.::.|.::
plant   476 FRFKMADENSKVSYKKMLTLHVDGGLHL 503

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cyp4g1NP_525031.1 p450 58..518 CDD:278495 111/454 (24%)
CYP704A1NP_850427.2 CYP86A 69..501 CDD:410687 113/479 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 1 1.000 151 1.000 Domainoid score I1385
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1247045at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 1 1.000 - - mtm8393
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X23
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
44.010

Return to query results.
Submit another query.