DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cyp4g1 and Cyp4x1

DIOPT Version :9

Sequence 1:NP_525031.1 Gene:Cyp4g1 / 30986 FlyBaseID:FBgn0010019 Length:556 Species:Drosophila melanogaster
Sequence 2:NP_001003947.1 Gene:Cyp4x1 / 81906 MGIID:1932403 Length:507 Species:Mus musculus


Alignment Length:532 Identity:149/532 - (28%)
Similarity:248/532 - (46%) Gaps:69/532 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly    35 LVAMALYEYWRRNSREYRMVANIPSPPELPILGQAHVAAGLSNAEILAVGLGYLNKYGETMKAWL 99
            ||.|...:.:.|..|..|.::..|.||...:||....... .|.|.|.   ..:.|:......|:
Mouse    24 LVLMQAMKLYLRRQRLLRDLSPFPGPPAHWLLGHQKFLQE-DNMETLD---EIVKKHPCAFPCWV 84

  Fly   100 GNVLLVF-LTNPSDIELILSG--------HQHLTKAEEYRYFKPWFGDGLLISNGHHWRHHRKMI 155
            |.....| :.:|...::.||.        ||.||         |..|.|||..:|..|..||.::
Mouse    85 GPFQAFFYIYDPDYAKIFLSRTDPKMQYLHQLLT---------PCIGRGLLNLDGPRWFQHRCLL 140

  Fly   156 APTFHQSILKSFVPTFVDHSKAVV----ARMGLEAGKSFDVHDYMSQTTVDILLSTAMGVKKLPE 216
            .|.|||.|||..|.|.. ||..|:    .:|......:.:|.::::..|:||::..|.|.:...:
Mouse   141 TPAFHQDILKPCVDTMA-HSVKVMLDKWEKMWTTQETTIEVFEHINLMTLDIIMKCAFGQETNCQ 204

  Fly   217 GNKSFE-YAQAVVDMCDIIHKRQVKLLYRLDSIYKFTKLREKG---DRMMNIILGMTSKVVKDRK 277
            .|.::| |.:|..::.:||..|.....:..|.|:   ||..||   ..:..:|...|.|:::|||
Mouse   205 INGTYESYVKATFELGEIISSRLYNFWHHHDIIF---KLSPKGHCFQELGKVIHQYTEKIIQDRK 266

  Fly   278 ENFQEESRAIVEEISTPVASTPASKKEGLRDDLDDIDENDVGAKRRLALLDAMVEMAKNPDIEWN 342
            :..:.:.:.                        ||...:.:       .||.::......:..::
Mouse   267 KILKNQVKQ------------------------DDTQTSQI-------FLDIVLSAQAEDERAFS 300

  Fly   343 EKDIMDEVNTIMFEGHDTTSAGSSFALCMMGIHKDIQAKVFAEQKAIFGDNMLRDCTFADTMEMK 407
            :.|:..||||.|:.|||.::|..|:.|..:.::.:.|.:...|.::|.||.  ...|:....||.
Mouse   301 DADLRAEVNTFMWAGHDASAASISWLLYCLALNPEHQDRCRTEIRSILGDG--SSITWEQLDEMS 363

  Fly   408 YLERVILETLRLYPPVPLIARRLDYDLKLASGPYTVPKGTTVIVLQYCVHRRPDIYPNPTKFDPD 472
            |....|.|||||.||||.|:|.|...|.|..| :::|.|.||::..:.:|..|.::.:|..|||.
Mouse   364 YTTMCIKETLRLIPPVPSISRELSKPLTLPDG-HSLPAGMTVVLSIWGLHHNPAVWNDPKVFDPL 427

  Fly   473 NFLPERMANRHYYSFIPFSAGPRSCVGRKYAMLKLKVLLSTIVRNYIVHSTDTEADFKLQADIIL 537
            .|..|....||..:|:|||:|||:|:|:::|||:|||.::.|:.::.| :.|........:..:|
Mouse   428 RFTKENSDQRHPCAFLPFSSGPRNCIGQQFAMLELKVAIALILLHFQV-APDLTRPPAFSSHTVL 491

  Fly   538 KLENGFNVSLEK 549
            :.::|..:.|:|
Mouse   492 RPKHGIYLHLKK 503

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cyp4g1NP_525031.1 p450 58..518 CDD:278495 137/476 (29%)
Cyp4x1NP_001003947.1 p450 47..499 CDD:278495 141/503 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1247045at2759
OrthoFinder 1 1.000 - - FOG0000016
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X23
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
43.920

Return to query results.
Submit another query.