DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cyp4g1 and cyp4f2

DIOPT Version :9

Sequence 1:NP_525031.1 Gene:Cyp4g1 / 30986 FlyBaseID:FBgn0010019 Length:556 Species:Drosophila melanogaster
Sequence 2:NP_001016020.1 Gene:cyp4f2 / 548774 XenbaseID:XB-GENE-6258041 Length:528 Species:Xenopus tropicalis


Alignment Length:524 Identity:158/524 - (30%)
Similarity:267/524 - (50%) Gaps:44/524 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly    34 TLVAMALYEY-WRRNSREYRMVANIPSPPELP-ILGQAHVAAGLSNAEILAVGLGYLNKYGETMK 96
            |:..||:|.| :..|:|..|.   .|.||... :||  |:...:...|.|......:.....|:.
 Frog    38 TIFKMAIYIYAYIINARRLRC---FPEPPRRSWLLG--HLGMFMPTEEGLTEISSAICNLRRTLL 97

  Fly    97 AWLGNVLLVFLTNPSDIELILSGHQHLTKAEE--YRYFKPWFGDGLLISNGHHWRHHRKMIAPTF 159
            .|||.:..|.|.:|..::.:::....:...:|  |.:.:||.|||||:|.|..|..||:::.|.|
 Frog    98 TWLGPIPEVSLVHPDTVKPVVAASAAIAPKDELFYGFLRPWLGDGLLLSRGEKWGQHRRLLTPAF 162

  Fly   160 HQSILKSFVPTFVDHSKAVVA---RMGLEAGKSFDVHDYMSQTTVDILLSTAMGVKKLPEGNKSF 221
            |..|||::|..|...:..::|   |:..|...|.|:.:::|..|:|.||..........: .|..
 Frog   163 HFDILKNYVKIFNQSTDIMLAKWRRLTAEGPVSLDMFEHVSLMTLDTLLKCTFSYDSDCQ-EKPS 226

  Fly   222 EYAQAVVDMCDIIHKRQVKLLYRLDSIYKFTKLREKGDRMMNIILGMTSKVVKDRKENFQEESRA 286
            :|..|:.::..::.||:..|.:..|.||..:....|..:....:...|:.||:.||:..||:.  
 Frog   227 DYISAIYELSSLVVKREHYLPHHFDFIYNLSSNGRKFRQACKTVHEFTAGVVQQRKKALQEKG-- 289

  Fly   287 IVEEISTPVASTPASKKEGLRDDLDDIDENDVGAKRRLALLDAMVEMAKNPD-IEWNEKDIMDEV 350
             :||.        ...|:|...|..||            ||     ::||.| .:.:::|:..||
 Frog   290 -MEEW--------IKSKQGKTKDFIDI------------LL-----LSKNEDGSQLSDEDMRAEV 328

  Fly   351 NTIMFEGHDTTSAGSSFALCMMGIHKDIQAKVFAEQKAIFGDNMLRDCTFADTMEMKYLERVILE 415
            :|.||||||||::|.|:.|..:..|.:.|.|...|...:.....::...:.:..::.:....|.|
 Frog   329 DTFMFEGHDTTASGLSWILYNLACHPEYQEKCRKEITELLEGKDIKHLEWDELSKLPFTTMCIKE 393

  Fly   416 TLRLYPPVPLIARRLDYDLKLASGPYTVPKGTTVIVLQYCVHRRPDIYPNPTKFDPDNFLPERMA 480
            :|||:|||..:.||...|:||..|. .:|||...|:..:.:|..||::|||..:||..|.||.:.
 Frog   394 SLRLHPPVVAVIRRCTEDIKLPKGD-ILPKGNCCIINIFGIHHNPDVWPNPQVYDPYRFDPENLQ 457

  Fly   481 NRHYYSFIPFSAGPRSCVGRKYAMLKLKVLLSTIVRNYIVHSTDTEADFKLQADIILKLENGFNV 545
            .|..|:|:|||||||:|:|:.:||.::|::|:.|:.|:.|...:|:. .:.:.::||:.|||..:
 Frog   458 ERSSYAFVPFSAGPRNCIGQNFAMAEMKIVLALILYNFQVRLDETKT-VRRKPELILRAENGLWL 521

  Fly   546 SLEK 549
            .:|:
 Frog   522 QVEE 525

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cyp4g1NP_525031.1 p450 58..518 CDD:278495 141/466 (30%)
cyp4f2NP_001016020.1 p450 60..513 CDD:278495 144/485 (30%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1247045at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.