DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cyp4g1 and sad

DIOPT Version :9

Sequence 1:NP_525031.1 Gene:Cyp4g1 / 30986 FlyBaseID:FBgn0010019 Length:556 Species:Drosophila melanogaster
Sequence 2:NP_650123.1 Gene:sad / 44858 FlyBaseID:FBgn0003312 Length:520 Species:Drosophila melanogaster


Alignment Length:538 Identity:110/538 - (20%)
Similarity:200/538 - (37%) Gaps:148/538 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly    57 IPSPPELPILGQA--HVAAGLSNAEILAVGLGYLNKYGETMKAWLGNVLLVFLTNPSDIELILSG 119
            ||....||::|..  .:|||         |..:|:||.:......|.:....|....|...:.|.
  Fly    59 IPRVKGLPVVGTLVDLIAAG---------GATHLHKYIDARHKQYGPIFRERLGGTQDAVFVSSA 114

  Fly   120 H------QHLTKAEEYRYFKPW--------FGDGLLISNGHHWRHHRKMIAPTFHQSILKSFVPT 170
            :      ||..:..::.....|        ...||....|..|.|:|:::    ::.:|...:..
  Fly   115 NLMRGVFQHEGQYPQHPLPDAWTLYNQQHACQRGLFFMEGAEWLHNRRIL----NRLLLNGNLNW 175

  Fly   171 FVDHSKAVVARM------------GLEAGKSFDVHDY--------MSQTTVDILLSTAMGVKKL- 214
            ...|.::...||            .:...:|.::..|        :.:.::::|.....|...| 
  Fly   176 MDVHIESCTRRMVDQWKRRTAEAAAIPLAESGEIRSYELPLLEQQLYRWSIEVLCCIMFGTSVLT 240

  Fly   215 -PEGNKSFEYAQAVVDMCDIIHKRQVKLLYRLDSIYKFTKLREKGDRMMNI------ILGMTSKV 272
             |:...|.:|      ...|:|                 |:.|...|:|..      ||.:  .:
  Fly   241 CPKIQSSLDY------FTQIVH-----------------KVFEHSSRLMTFPPRLAQILRL--PI 280

  Fly   273 VKDRKENFQE---ESRAIVEEISTPVASTPASKKEGLRDDLDDIDENDVGAKRRLALLDAMVEMA 334
            .:|.:.|..|   |..||::..              :|...|....:|.....||...|...:|.
  Fly   281 WRDFEANVDEVLREGAAIIDHC--------------IRVQEDQRRPHDEALYHRLQAADVPGDMI 331

  Fly   335 KNPDIEWNEKDIMDEVNTIMFEGHDTTSAGSSFALCMMGIHKDIQAKVFAEQKAIFGDNMLRDCT 399
            |...::            ::....|||:..|.:||..:.....:|.:: |:::|           
  Fly   332 KRIFVD------------LVIAAGDTTAFSSQWALFALSKEPRLQQRL-AKERA----------- 372

  Fly   400 FADTMEMKYLERVILETLRLYPPVPLIARRLDYDLKLASGPYTVPKGTTVIVLQYCVHRRPDIYP 464
               |.:.:.:..:|.|:|||||..|.|.|.|..|.:|  |.:.:.|.|.|::..|...|      
  Fly   373 ---TNDSRLMHGLIKESLRLYPVAPFIGRYLPQDAQL--GGHFIEKDTMVLLSLYTAGR------ 426

  Fly   465 NPTKFD-PDNFLPER-------MANRHYYSFIPFSAGPRSCVGRKYAMLKLKVLLSTIVRNYIVH 521
            :|:.|: |:..||||       ..::.:.| :||:.|.|||:||:.|:.:|..||......:.:.
  Fly   427 DPSHFEQPERVLPERWCIGETEQVHKSHGS-LPFAIGQRSCIGRRVALKQLHSLLGRCAAQFEMS 490

  Fly   522 STDTEADFKLQADIILKL 539
            ..:     ::..|.:|::
  Fly   491 CLN-----EMPVDSVLRM 503

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cyp4g1NP_525031.1 p450 58..518 CDD:278495 107/514 (21%)
sadNP_650123.1 p450 63..497 CDD:299894 106/526 (20%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24291
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.