DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cyp4g1 and Cyp316a1

DIOPT Version :9

Sequence 1:NP_525031.1 Gene:Cyp4g1 / 30986 FlyBaseID:FBgn0010019 Length:556 Species:Drosophila melanogaster
Sequence 2:NP_648129.2 Gene:Cyp316a1 / 38840 FlyBaseID:FBgn0035790 Length:484 Species:Drosophila melanogaster


Alignment Length:546 Identity:134/546 - (24%)
Similarity:235/546 - (43%) Gaps:90/546 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly    31 LVGTLVAMAL---YEYWRRNSREYRMVANIPSPPELPILGQAHVAAGLSNAEILAVGLGYLNKYG 92
            |..|.:...|   :.|:|.. |:..::.|:..|...|::|..|....|:..........||.|||
  Fly     3 LTATFICFCLASAFNYFRAR-RQRSLIKNLKGPFTWPLMGAMHKLLFLTPINFFQRSTEYLTKYG 66

  Fly    93 ETMKAWLGNVLLVFLTNPSDIEL---ILSGHQHLTKAEEYRYFKPWFGDGLLISNGHHWRHHRKM 154
            ...:.|:.:.|.:.|   :|:||   :|....||...  |...|.|...|:|:.....|:....:
  Fly    67 TFSRCWVFHRLFIPL---ADLELSRQLLENDTHLETG--YELMKDWLVGGVLMCQSEQWQKRHSL 126

  Fly   155 IAPTFHQSILKSFVPTFVDHSKAVVARMGLEAG-KSFDVHDYMSQTTVDILLSTAMGVKKLPEGN 218
            |:..|.:..|:..:......::.::.::..:|. |.||:...:|...:|:::.|..|.|      
  Fly   127 ISGLFDKGNLEQLIDLSRHQTEQLLQKLAKQADQKVFDIWYTVSPIVLDLMVMTTCGAK------ 185

  Fly   219 KSFEYAQAVVDMCDIIHKRQVKLL------YRLDSIYKFTKLREKGDRMMNIILGMTSKVVKDRK 277
            .|.||::.:.|:.:|..||.:.|.      |.|.|.:    :|::.:|::        |.:.|..
  Fly   186 PSEEYSKNLKDLSEIYRKRFLSLQSANRFNYWLSSPF----MRKRQNRLI--------KRLNDEH 238

  Fly   278 ENFQEESRAIVEEISTPVASTPASKKEGLRDDLDDIDENDVGAKRRLALLDAMVEMAKNPDIEWN 342
            .|.              :|...:..:..:.:.||......:..|...:||:.::| :|:|.:...
  Fly   239 NNL--------------MAMHQSQNQLKIENGLDIYQLRPIPLKDHKSLLEILLE-SKDPQLTGE 288

  Fly   343 EKDIMDEVNTIMFEGHDTTSAGSSFALCMMGIHKDIQAKVFAEQKAIFGDNMLRDCTFADTMEMK 407
            |  |..|:||..:.|:...|....|.|..:..:..:|.|...|....    .::|..: |..::.
  Fly   289 E--ICGELNTCNYLGYQLCSPALCFCLVTIARNPSVQQKCLDELNLA----QIKDQGW-DLEKLN 346

  Fly   408 YLERVILETLRLYPPVPLIARRLDYDLKLASGPYT--------VPKGTTVIVLQYCVHRRPDIYP 464
            ||:.|:.||:|||||..::.|:|..|.     |||        :|.|:.:.:..|.:.|....||
  Fly   347 YLDAVLHETMRLYPPQVIVGRQLKKDF-----PYTHSIVGDAELPCGSEIYINLYELQRNEVRYP 406

  Fly   465 NPTKFDPDNFL---PERMANRHYYSFIPFSAGPRSCVGRKYAMLKLKVLLSTIVRNYIV--HSTD 524
            ....||...||   ||         .:.:|.|||.|..||::|..||.||:.|:.|:.|  :..:
  Fly   407 KANHFDAQRFLDSPPE---------LLSYSLGPRCCPARKFSMQLLKTLLAPILANFEVLPYGDE 462

  Fly   525 TEADFKLQADIILKLENGFNVSLEKR 550
            ...|.:|    :|...|||.::|:.|
  Fly   463 VRLDLRL----VLGSSNGFQLALKPR 484

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cyp4g1NP_525031.1 p450 58..518 CDD:278495 117/480 (24%)
Cyp316a1NP_648129.2 p450 33..466 CDD:299894 119/491 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 101 1.000 Domainoid score I1781
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 102 1.000 Inparanoid score I1639
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1247045at2759
OrthoFinder 1 1.000 - - FOG0000016
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24291
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
66.070

Return to query results.
Submit another query.