DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cyp4g1 and CYP96A10

DIOPT Version :9

Sequence 1:NP_525031.1 Gene:Cyp4g1 / 30986 FlyBaseID:FBgn0010019 Length:556 Species:Drosophila melanogaster
Sequence 2:NP_001031814.1 Gene:CYP96A10 / 3770599 AraportID:AT4G39490 Length:519 Species:Arabidopsis thaliana


Alignment Length:501 Identity:122/501 - (24%)
Similarity:215/501 - (42%) Gaps:111/501 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly   101 NVLLVFLTNPSDIELILSGH-QHLTKAEEYRYFKPWFGDGLLISNGHHWRHHRK-----MIAPTF 159
            |:.::...:|::|..|:|.: .:..|..|::......|||:..::...|:..||     |:.|.|
plant    76 NLDMLVTVDPANIHHIMSSNFANYPKGPEFKKLFDILGDGIFNADSELWKDLRKSAQSMMMNPEF 140

  Fly   160 HQSIL--------KSFVPTFVDHSKAVVARMGLEAGKSFDVHDYMSQTTVDILLSTAMGVK---- 212
            .:..|        |..|| .:||    ||:..|    :.|:.|...:.|.|.....|.|..    
plant   141 QKFSLATSLKKLEKGLVP-LLDH----VAKEKL----AVDLQDMFQRFTFDTTFVLATGYDPGCL 196

  Fly   213 --KLPEGNKSFEYAQAVVDMCDIIHKRQVK--LLYRLDSIY------KFTKLREKGDRMMNIILG 267
              ::||    .|:|:|:.|..:.|..|.||  :.:||..:.      |.||.|...||       
plant   197 SVEMPE----VEFARALDDAEEAIFFRHVKPEIFWRLQGLLGLGDEKKMTKARSTLDR------- 250

  Fly   268 MTSKVVKDRKENFQEESRAIVEEISTPVASTPASKKEGLRDDLDDIDENDVGAKRRLALLDAMVE 332
            :.||.:..::           :|:|....:..:..|:.|...::               ||....
plant   251 VCSKYIAIKR-----------DEVSRGTNNVDSHSKDLLTSYMN---------------LDTTKY 289

  Fly   333 MAKNPDIEWNEKDIMDEVNTIMFEGHDTTSAGSSFALCMMGIHKDIQAKVFAE-QKAIFGDNML- 395
            ...||.   :|:.:.|.:.|.|..|.|||.:|.::...::..:.::.||:..| ..|:|..:.: 
plant   290 KLLNPS---DERFLRDTILTFMLAGRDTTGSGLTWFFWLLIKNPEVIAKIRQEINTALFQRSKVD 351

  Fly   396 ------RDCTFADTMEMK---YLERVILETLRLYPPVPLIARRLDYDLKLASGPYTVPKG----- 446
                  .|.......|:|   ||...|.|:||||||||       :..|..:.|..:|.|     
plant   352 DDASNNNDSDSFSPQELKKLVYLHGAICESLRLYPPVP-------FQHKSPTKPDVLPSGHKVDA 409

  Fly   447 -TTVIVLQYCVHRRPDIY-PNPTKFDPDNFLPERMANRH--YYSFIPFSAGPRSCVGRKYAMLKL 507
             :.::...|.:.|...:: .:..:|.|:.::.|...:.|  .|.|:.|:||||:|:|::.||:::
plant   410 NSKILFCLYSLGRMKSVWGEDALEFKPERWISESGNSVHEPSYKFLSFNAGPRTCLGKEVAMMQM 474

  Fly   508 KVLLSTIVRNY---IVHSTDTEADFKLQADIILKLENGFNVSLEKR 550
            |.:...|::||   ||.....|.    ...:||.:::|..|::.||
plant   475 KSVAVKIIQNYEMKIVEGQQIEP----APSVILHMKHGLKVTVTKR 516

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cyp4g1NP_525031.1 p450 58..518 CDD:278495 111/464 (24%)
CYP96A10NP_001031814.1 CYP86A 68..509 CDD:410687 118/492 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 1 1.000 151 1.000 Domainoid score I1385
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1247045at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 1 1.000 - - mtm8393
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X23
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
44.010

Return to query results.
Submit another query.