DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cyp4g1 and Cyp6t3

DIOPT Version :9

Sequence 1:NP_525031.1 Gene:Cyp4g1 / 30986 FlyBaseID:FBgn0010019 Length:556 Species:Drosophila melanogaster
Sequence 2:NP_610745.1 Gene:Cyp6t3 / 36318 FlyBaseID:FBgn0033697 Length:501 Species:Drosophila melanogaster


Alignment Length:551 Identity:120/551 - (21%)
Similarity:213/551 - (38%) Gaps:112/551 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly    35 LVAMALYEYWRRNSREY---RMVANIPSPPELPILGQAHVAAGLSNAEILAVGLGYL-------- 88
            |:.:....:|.|:..:|   |.:.::|.....|:       ..|.....|.:..|.|        
  Fly     8 LLTIVTLNFWLRHKYDYFRSRGIPHLPPSSWSPM-------GNLGQLLFLRISFGDLFRQLYADP 65

  Fly    89 -NKYGETMKAWLGNVLLVFLTNPSDIE--LILSGHQHLTKAEEYRYFKPWFGDGLLISNGHHWRH 150
             |...:.:..::.....:.:.:|..|.  ||.:.:..|.:.|......|.....|.::..|||:.
  Fly    66 RNGQAKIVGFFIFQTPALMVRDPELIRQVLIKNFNNFLNRFESADAGDPMGALTLPLAKYHHWKE 130

  Fly   151 HRKMIAPTFHQSILKSFVPTFVDHSKAVVARMGLEAGKSFDVHDYMSQTTVDILLSTAMGVKKLP 215
            .|:.::..|....::.           |:....|:...  |:..|:::...|.|      .:.||
  Fly   131 SRQCMSQLFTSGRMRD-----------VMYSQMLDVAS--DLEQYLNRKLGDRL------ERVLP 176

  Fly   216 EGNKSFEYAQAVVDMCDIIHKRQVKLLYRLDSIYKFTKLREKGDRMMNIILG----MTSKVVKDR 276
            .|.           ||.         ||..|         ..|:...::.:|    ..|:::...
  Fly   177 LGR-----------MCQ---------LYTTD---------VTGNLFYSLNVGGLRRGRSELITKT 212

  Fly   277 KENFQEESRAIVEEIST-----------PVASTP--ASKKEGLRDDLDDIDEND-VGAKRRLALL 327
            ||.|....|.:::.:|.           |...|.  |.....|.||..:..:.| :...:...|.
  Fly   213 KELFNTNPRKVLDFMSVFFLPKWTGVLKPKVFTEDYARYMRHLVDDHHEPTKGDLINQLQHFQLS 277

  Fly   328 DAMVEMAKNPDIEWNEKDIMDEVNTIMFEGHDTTSAGSSFALCMMGIHKDIQAKVFAEQKAIFGD 392
            .:....:::||.      :..:...|:..|.:|:||...|.|..:....|||.::.:|.:..|  
  Fly   278 RSSNHYSQHPDF------VASQAGIILLAGFETSSALMGFTLYELAKAPDIQERLRSELREAF-- 334

  Fly   393 NMLRDCTFA-DT-MEMKYLERVILETLRLYPPVPLIARRLDYDLKLASG-------PYTVPKGTT 448
              :...|.: || |.:.||:.|.||.|||||....:.|  :.....:.|       .:.||.|..
  Fly   335 --ISTATLSYDTLMTLPYLKMVCLEALRLYPAAAFVNR--ECTSSASEGFSLQPHVDFIVPPGMP 395

  Fly   449 VIVLQYCVHRRPDIYPNPTKFDPDNFLPERMANRHYYSFIPFSAGPRSCVGRKYAMLKLKVLLST 513
            ..:....:||....:|.|..|||:.|.|||..:.|..::|||.|||..|:|.:..:|:||:.:..
  Fly   396 AYISILGLHRDERFWPEPCVFDPERFGPERSRHIHPMTYIPFGAGPHGCIGSRLGVLQLKLGIVH 460

  Fly   514 IVRNYIVHS---TDTEADFKLQADIILKLEN 541
            |::.|.|.:   |.:|..|..:: .:|:.||
  Fly   461 ILKQYWVETCERTVSEIRFNPKS-FMLESEN 490

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cyp4g1NP_525031.1 p450 58..518 CDD:278495 107/497 (22%)
Cyp6t3NP_610745.1 p450 34..486 CDD:299894 112/519 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1247045at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.