DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cyp4g1 and Cyp46a1

DIOPT Version :9

Sequence 1:NP_525031.1 Gene:Cyp4g1 / 30986 FlyBaseID:FBgn0010019 Length:556 Species:Drosophila melanogaster
Sequence 2:XP_006240610.1 Gene:Cyp46a1 / 362782 RGDID:1306605 Length:500 Species:Rattus norvegicus


Alignment Length:516 Identity:118/516 - (22%)
Similarity:228/516 - (44%) Gaps:85/516 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly    25 SPMLTTLVGTLVAMAL-----YEYWRRNSREYRMVANIPSPP-------ELPILGQAHVAAGLSN 77
            ||.| .|:|:.|.:|.     :.:..|:..|:     ||.||       .||...:...|.|...
  Rat     2 SPGL-LLLGSAVLLAFGLCCTFVHRARSRYEH-----IPGPPRPSFLLGHLPYFWKKDEACGRVL 60

  Fly    78 AEILAVGLGYLNKYGETMKAWLGNVLLVFLTNPSDIELILSGHQHLTKAEEYRYFKPWFGDGL-- 140
            .::.   |.:..|||..::..:.:...|.:|:|..::..|...::...::.||..:..||:.|  
  Rat    61 QDVF---LDWAKKYGPVVRVNVFHKTSVIVTSPESVKKFLMSTKYNKDSKMYRAIQTVFGERLFG 122

  Fly   141 --LISNGHH--WRHHRKMIAPTFHQSILKSFVPTFVDHSKAVVARMGLEA-GKS-FDVHDYMSQT 199
              |:|...:  |...|:::...|.:|.|.|.:.||.:.::.::..:..:| |:: ..:.|.::..
  Rat   123 QGLVSECDYGRWYKQRRVMDLAFSRSSLVSLMGTFNEKAEQLMEILEAKADGQTPVSMQDMLTCA 187

  Fly   200 TVDILLSTAMGVKKLPEGNKSFEYAQAVVDMCDIIHKRQVKLLYRLDSIYKFTKLREKGDRMMNI 264
            |:|||...|.|::...........:|||..|.:.|...:       :::.||...:.|..|.:..
  Rat   188 TIDILAKAAFGMETSMLLGAQKPLSQAVKVMLEGISASR-------NTLAKFMPGKRKQLREIRE 245

  Fly   265 ILGMTSKVVKD----RKENFQEESRAIVEEISTPVASTPASKKEGLRDDLDDIDENDVGAKRRLA 325
            .:.:..:|.||    |:|..:..     |::...:.:.....:||.:||                
  Rat   246 SIRLLRQVGKDWVQRRREALKRG-----EDVPADILTQILKAEEGAQDD---------------- 289

  Fly   326 LLDAMVEMAKNPDIEWNEKDIMDEVNTIMFEGHDTTSAGSSFALCMMGIHKDIQAKVFAEQKAIF 390
                              :.::|...|....||:|::...:|.:..:....:|.|::.||...:.
  Rat   290 ------------------EVLLDNFVTFFIAGHETSANHLAFTVMELSRQPEIVARLQAEVDEVV 336

  Fly   391 GDNMLRDCTFADTMEMKYLERVILETLRLYPPVPLIARRLDYDLKLASGPYTVPKGTTVIVLQYC 455
            |..  |...:.|...::||.:|:.|:||||||.....|.|:.: .|..| ..||..|.::...|.
  Rat   337 GSK--RHLDYEDLGRLQYLSQVLKESLRLYPPAWGTFRLLEEE-TLIDG-VRVPGNTPLLFSTYV 397

  Fly   456 VHRRPDIYPNPTKFDPDNFLPERMANRHYYSFIPFSAGPRSCVGRKYAMLKLKVLLSTIVR 516
            :.|....:.:|..|:||.|.|.  |.:..:::.|||.|.|||:|:::|.:::||:::.:::
  Rat   398 MGRMDTYFEDPLTFNPDRFGPG--APKPRFTYFPFSLGHRSCIGQQFAQMEVKVVMAKLLQ 456

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cyp4g1NP_525031.1 p450 58..518 CDD:278495 108/478 (23%)
Cyp46a1XP_006240610.1 p450 34..466 CDD:278495 108/478 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
11.000

Return to query results.
Submit another query.