DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cyp4g1 and Cyp6t1

DIOPT Version :9

Sequence 1:NP_525031.1 Gene:Cyp4g1 / 30986 FlyBaseID:FBgn0010019 Length:556 Species:Drosophila melanogaster
Sequence 2:NP_608457.1 Gene:Cyp6t1 / 33127 FlyBaseID:FBgn0031182 Length:529 Species:Drosophila melanogaster


Alignment Length:589 Identity:133/589 - (22%)
Similarity:221/589 - (37%) Gaps:144/589 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly    24 FSPMLTTL-VGTLVAMAL--------------------YEYWRRNSREYRMVANIPSPPELPILG 67
            ||.:...| ||:||.:.:                    :.:|||        ..:|..|..|.:|
  Fly     5 FSLIAAALAVGSLVLLPVVLRGGCLLVVTIVWLWQILHFWHWRR--------LGVPFVPAAPFVG 61

  Fly    68 --------------------QAHVAAGLSNAEILAVGLGYLNKYGETMKAWLGNVLLVFLTNPSD 112
                                ::..|||.:     .||:..|:.:.            :.|.:|:.
  Fly    62 NVWNLLRGACCFGDQFRELYESKEAAGRA-----FVGIDVLHNHA------------LLLRDPAL 109

  Fly   113 IELILSGHQHLTKAEEYRYFKPWF-----------GDGLLISNGHHWRHHRKMIAPTF------- 159
            |:.|:        .|::..|...|           ...|..|....||...|:.||.|       
  Fly   110 IKRIM--------VEDFAQFSSRFETTDPTCDTMGSQNLFFSKYETWRETHKIFAPFFAAGKVRN 166

  Fly   160 HQSILKSFVPTFVDH-SKAVVARMGLEAGKSFDVHDYMSQTTVDILLSTAMGVKKLPEGNKSFEY 223
            ...:|::......:| .:.:..|..:|    .:|....:..|.||:.|.|.|::.....|...|:
  Fly   167 MYGLLENIGQKLEEHMEQKLSGRDSME----LEVKQLCALFTTDIIASLAFGIEAHSLQNPEAEF 227

  Fly   224 AQAVVDMCDIIHKRQVKLLYRLDSIYKFTKLREK-GDRMMNIILGMTSKVVKDRKENFQEESRAI 287
            .:    ||..::..:.|.|..|.:::.|.:|..: |..:                  :.||....
  Fly   228 RR----MCIEVNDPRPKRLLHLFTMFFFPRLSHRVGTHL------------------YSEEYERF 270

  Fly   288 VEEISTPVASTPASKKEGLRDDLDDIDENDVGAKRRLALLDAMVEMAKNPDIEWNEKDIMDEVNT 352
            :.:....|.|..|...|. |.||.||       ..:|...:....:...||.      ...:...
  Fly   271 MRKSMDYVLSQRAESGEN-RHDLIDI-------FLQLKRTEPAESIIHRPDF------FAAQAAF 321

  Fly   353 IMFEGHDTTSAGSSFALCMMGIHKDIQAKVFAEQKAIFGDNMLRDCTFADTMEMKYLERVILETL 417
            ::..|.||:|:..:|||..:..:..||.::..|.:|....:..|..:......:.||.:|:.|.|
  Fly   322 LLLAGFDTSSSTITFALYELAKNTTIQDRLRTELRAALQSSQDRQLSCDTVTGLVYLRQVVDEVL 386

  Fly   418 RLYPPVPLIAR----RLDYDLKLASG--PYTVPKGTTVIVLQYCVHRRPDIYPNPTKFDPDNFLP 476
            |||||...:.|    |..|||...:|  |:.:..||.|.:....:||....:|||..|||:.|..
  Fly   387 RLYPPTAFLDRCCNSRTGYDLSPWNGGSPFKLRAGTPVYISVLGIHRDAQYWPNPEVFDPERFSA 451

  Fly   477 ERMANRHYYSFIPFSAGPRSCVGRKYAMLKLKVLLSTIVRNY---IVHSTDTEADFKLQADIILK 538
            |:....|..:::||.||||.|:|.....|::||.|..|:.::   :...|..|..|..:| .:|.
  Fly   452 EQRQQHHPMTYLPFGAGPRGCIGTLLGQLEIKVGLLHILNHFRVEVCERTLPEMRFDPKA-FVLT 515

  Fly   539 LENG 542
            ..||
  Fly   516 AHNG 519

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cyp4g1NP_525031.1 p450 58..518 CDD:278495 116/505 (23%)
Cyp6t1NP_608457.1 p450 91..515 CDD:299894 113/484 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1247045at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.920

Return to query results.
Submit another query.