DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cyp4g1 and Cyp28c1

DIOPT Version :9

Sequence 1:NP_525031.1 Gene:Cyp4g1 / 30986 FlyBaseID:FBgn0010019 Length:556 Species:Drosophila melanogaster
Sequence 2:NP_001259464.1 Gene:Cyp28c1 / 32138 FlyBaseID:FBgn0030339 Length:505 Species:Drosophila melanogaster


Alignment Length:571 Identity:118/571 - (20%)
Similarity:218/571 - (38%) Gaps:145/571 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly    28 LTTLVGTLVAMAL--YEYWRRNSREYRMVANIPSPPELPILG--------QAHVAAGLSNAEILA 82
            :.||:|.:.|..:  :.:|||.        .:..|..||:.|        :.|....:.:     
  Fly     9 IATLLGAIYAFLVSNFGHWRRR--------GVTEPRALPLFGSFPNMIWPRQHFTMDMRD----- 60

  Fly    83 VGLGYLNKYGETMKAWLGNVLL----VFLTNPSDI-ELILSGHQHLTKAEEYRY----------F 132
            :.:.|.|.:     :::|..||    :.:..|..: |:.:|...|....:..:.          .
  Fly    61 IYMHYRNTH-----SYVGCYLLRAPKLLVLEPRLVYEIYVSAFSHFENNDASKMVDIAKDRLVAL 120

  Fly   133 KPWFGDGLLISNGHHWRHHRKMIAPTFHQSILKSFVPTFVDHSKAVVARMGLE----------AG 187
            .|:      :..|..|||.|.:.:.......:::        :.|::.|:.|:          .|
  Fly   121 NPF------VLEGEEWRHQRAVFSTLLTNGRIRT--------THAIMQRVCLDLCQFIAIKSAGG 171

  Fly   188 KSFDVHDYMSQTTVDILLSTAMGVK-------KLPEGNKSFEYAQAVVDMCDIIHKRQVKLLYRL 245
            |..|..|...:.|.:.|....:|::       .||...::.|.:         ...|.:.:...:
  Fly   172 KDLDCIDLGLRFTGESLFDCVLGIQARTFTDNPLPVVRQNHEMS---------AENRGLAIAGAV 227

  Fly   246 DSIYKFTK--LREK-----GDRMMNIILGMTSKVVKDRKENFQEESRAIVEEISTPVASTPASKK 303
            ..::....  ||.|     .||...   .|.|:.::.|:...||                     
  Fly   228 HGLFPNLPRWLRPKVFPRSHDRFYG---QMISEALRLRRSKHQE--------------------- 268

  Fly   304 EGLRDDLDDIDENDVGAKRRLALLDAMVEMAKNPDIEWNEKDIMDEVNTIMFEGHDTTSAGSSFA 368
                       .||        .::.::||.:..|:  :|:|:.....|.||:|.||||...:..
  Fly   269 -----------RND--------FINHLLEMQRELDL--SEEDMASHAMTFMFDGLDTTSNSIAHC 312

  Fly   369 LCMMGIHKDIQAKVFAEQKAIFGDNMLRDCTFADTM-EMKYLERVILETLRLYPPVPLIARRL-- 430
            |.::|.:.|.|.:::.|.:.:.....|.|   .|.: ::.||.....|:||:||.....::..  
  Fly   313 LLLLGRNPDCQRRLYEELQLVNPGGYLPD---LDALIDLPYLSACFNESLRIYPAGGWASKTCTK 374

  Fly   431 DYDLKLA--SGPYTVPKGTTVIVLQYCVHRRPDIYPNPTKFDPDNFLPERMAN-RHYYSFIPFSA 492
            :|:|:.:  |.|..:..|..|:|..|.:|..||:||.|..|.|:.||...:.| :....|:.|..
  Fly   375 EYELRGSHHSEPLKLRPGDHVMVPIYALHNDPDLYPEPDVFRPERFLDGGLKNCKQQGIFLGFGN 439

  Fly   493 GPRSCVGRKYAMLKLKVLLSTIVRNY-IVHSTDTEADFKLQADIILKLENG 542
            |||.|||.:..:...|..|:.||:.: :|.|..|....:|...|.:.:..|
  Fly   440 GPRQCVGMRLGLAMAKAALAAIVQRFEVVVSPRTLNGTELDPLIFVGVHKG 490

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cyp4g1NP_525031.1 p450 58..518 CDD:278495 105/512 (21%)
Cyp28c1NP_001259464.1 p450 35..487 CDD:299894 110/532 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.