DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cyp4g1 and Cyp4f39

DIOPT Version :9

Sequence 1:NP_525031.1 Gene:Cyp4g1 / 30986 FlyBaseID:FBgn0010019 Length:556 Species:Drosophila melanogaster
Sequence 2:NP_796281.1 Gene:Cyp4f39 / 320997 MGIID:2445210 Length:532 Species:Mus musculus


Alignment Length:553 Identity:166/553 - (30%)
Similarity:280/553 - (50%) Gaps:84/553 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly    31 LVGTLVAMALYEYWRRNSREYRMVAN----------IPSPPELP-ILGQAHVAAGLSNAEILAVG 84
            :|..|:.:.|:.::|...|.:::.::          .|.||... :||  |::..|.|.:    |
Mouse    23 VVSALLLLVLFFFFRLLVRAFKLFSDFRITCRKLSCFPEPPGRHWLLG--HMSMYLPNEK----G 81

  Fly    85 LGYLNKYGETMK----AWLGNVL-LVFLTNPSDIELILSGHQHLTKAEE--YRYFKPWFGDGLLI 142
            |....|..:||.    ||:|..| |:.|.:|..|:.:|.....:...:|  |.:.|||.||||||
Mouse    82 LQNEKKVLDTMHHIILAWVGPFLPLLVLVHPDYIKPVLGASAAIAPKDEFFYSFLKPWLGDGLLI 146

  Fly   143 SNGHHWRHHRKMIAPTFHQSILKSFVPTF-----VDHSKAVVARMGLEAGK--SFDVHDYMSQTT 200
            |.|:.|..||:::.|.||..|||.::..|     :.|:|   .|..|..|.  |||:.:::|..|
Mouse   147 SKGNKWSRHRRLLTPAFHFDILKPYMKIFNQCTNIMHAK---WRRHLAEGSVTSFDMFEHISLMT 208

  Fly   201 VDILLSTAMGVKKLPEGNKSFEYAQAVVDMCDIIHKRQVKLLYRLDSIYKFT----KLREKGDRM 261
            :|.|...........:...| :|..:::::..::.:||.:|.:.||.:|..|    :.|:..|.:
Mouse   209 LDSLQKCVFSYNSDCQERMS-DYISSIIELSALVVRRQYRLHHYLDFMYYLTADGRRFRQACDTV 272

  Fly   262 MNIILGMTSKVVKDRKENFQEESRAIVEEISTPVASTPASKKEGLRDDLDDIDENDVGAKRRLAL 326
            .|    .|::|:::|::..:::.           |......|:|  ..||.||          .|
Mouse   273 HN----FTTEVIQERRQALRQQG-----------AEAWLKAKQG--KTLDFID----------VL 310

  Fly   327 LDAMVEMAKNPDIEWNEKDIMDEVNTIMFEGHDTTSAGSSFALCMMGIHKDIQAKVFAEQKAIFG 391
            |.|..|..|    |.:::||..|.:|.|||||||||:|.|:||..:..:.:.|.|...|.:.:..
Mouse   311 LLAKDEEGK----ELSDEDIRAEADTFMFEGHDTTSSGLSWALFNLAKYPEYQEKCREEIQEVMK 371

  Fly   392 DNMLRDCTFADTMEMKYLERVILETLRLYPPVPLIARRLDYDLKLASGPYTVPKGTTVIVLQYCV 456
            ...|.:..:.|..::.:....|.|:||.:|||.||:||...|:||..| ..:|||...:|..|..
Mouse   372 GRELEELDWDDLTQLPFTTMCIKESLRQFPPVTLISRRCTEDIKLPDG-RVIPKGIICLVSIYGT 435

  Fly   457 HRRPDIYP-----NPTKFDPDNFLPERMANRHYYSFIPFSAGPRSCVGRKYAMLKLKVLLS-TIV 515
            |..|.::|     ||.:||||.  |::   |...:|:|||||||:|:|:.:||.:::|::: |::
Mouse   436 HHNPIVWPDSKVYNPYRFDPDT--PQQ---RSPLAFVPFSAGPRNCIGQSFAMAEMRVVVALTLL 495

  Fly   516 RNYIVHSTDTEADFKLQADIILKLENGFNVSLE 548
            |..:  |.|.....:.:.::||:.|||..:::|
Mouse   496 RFRL--SVDRTHKVRRKPELILRTENGLWLNVE 526

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cyp4g1NP_525031.1 p450 58..518 CDD:278495 153/484 (32%)
Cyp4f39NP_796281.1 p450 60..515 CDD:365848 155/503 (31%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1247045at2759
OrthoFinder 1 1.000 - - FOG0000016
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X23
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
43.920

Return to query results.
Submit another query.