DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cyp4g1 and CYP4A11

DIOPT Version :9

Sequence 1:NP_525031.1 Gene:Cyp4g1 / 30986 FlyBaseID:FBgn0010019 Length:556 Species:Drosophila melanogaster
Sequence 2:NP_000769.2 Gene:CYP4A11 / 1579 HGNCID:2642 Length:519 Species:Homo sapiens


Alignment Length:557 Identity:161/557 - (28%)
Similarity:257/557 - (46%) Gaps:75/557 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly    18 STTVLGFSPMLTTLVGTL---------------VAMALYEYWRRNSREYRMVANIPSPPELPILG 67
            |.:||..|.:|..:.|.|               |.:.|:..|.     .:.:...|.||...:.|
Human     2 SVSVLSPSRLLGDVSGILQAASLLILLLLLIKAVQLYLHRQWL-----LKALQQFPCPPSHWLFG 61

  Fly    68 QAHVAAGLSNAEILAVGLGYLNKYGETMKA----WL-GNVLLVFLTNPSDIELILSGHQHLTKAE 127
              |:.....:.|     |..:.|:.||..:    || |..:.|.|.:|..:::|| |........
Human    62 --HIQELQQDQE-----LQRIQKWVETFPSACPHWLWGGKVRVQLYDPDYMKVIL-GRSDPKSHG 118

  Fly   128 EYRYFKPWFGDGLLISNGHHWRHHRKMIAPTFHQSILKSFVPTFVDHSKAVVARMGLEAGKS--F 190
            .||:..||.|.|||:.||..|..||:|:.|.||..|||.:|....|..:.::.:.....|:.  .
Human   119 SYRFLAPWIGYGLLLLNGQTWFQHRRMLTPAFHYDILKPYVGLMADSVRVMLDKWEELLGQDSPL 183

  Fly   191 DVHDYMSQTTVDILLSTAMGVK-KLPEGNKSFEYAQAVVDMCDIIHKRQVKLLYRLDSIYKFTKL 254
            :|..::|..|:|.::..|...: .:.....|..|.||:.|:.:::..|.....::.|:||..|..
Human   184 EVFQHVSLMTLDTIMKCAFSHQGSIQVDRNSQSYIQAISDLNNLVFSRVRNAFHQNDTIYSLTSA 248

  Fly   255 REKGDRMMNIILGMTSKVVKDRKENFQEESRAIVEEISTPVASTPASKKEGLRDDLDDIDENDVG 319
            .....|...:....|.:|::.||...|                     |||   :|:.|..    
Human   249 GRWTHRACQLAHQHTDQVIQLRKAQLQ---------------------KEG---ELEKIKR---- 285

  Fly   320 AKRRLALLDAMVEMAK--NPDIEWNEKDIMDEVNTIMFEGHDTTSAGSSFALCMMGIHKDIQAKV 382
             ||.|..||.:: :||  |..| .::||:..||:|.||||||||::|.|:.|..:..|...|.:.
Human   286 -KRHLDFLDILL-LAKMENGSI-LSDKDLRAEVDTFMFEGHDTTASGISWILYALATHPKHQERC 347

  Fly   383 FAEQKAIFGDNMLRDCTFADTMEMKYLERVILETLRLYPPVPLIARRLDYDLKLASGPYTVPKGT 447
            ..|..::.||.  ...|:....:|.|....|.|.||||||||.|.|.|...:....| .::|||.
Human   348 REEIHSLLGDG--ASITWNHLDQMPYTTMCIKEALRLYPPVPGIGRELSTPVTFPDG-RSLPKGI 409

  Fly   448 TVIVLQYCVHRRPDIYPNPTKFDPDNFLPERMANRHYYSFIPFSAGPRSCVGRKYAMLKLKVLLS 512
            .|::..|.:|..|.::|||..|||..|.|.  :.:|.::|:|||.|.|:|:|:::||.:|||..:
Human   410 MVLLSIYGLHHNPKVWPNPEVFDPFRFAPG--SAQHSHAFLPFSGGSRNCIGKQFAMNELKVATA 472

  Fly   513 TIVRNYIVHSTDTEADFKLQADIILKLENGFNVSLEK 549
            ..:..:.:....|.....: |.::||.:||.::.|.:
Human   473 LTLLRFELLPDPTRIPIPI-ARLVLKSKNGIHLRLRR 508

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cyp4g1NP_525031.1 p450 58..518 CDD:278495 144/469 (31%)
CYP4A11NP_000769.2 p450 52..505 CDD:278495 150/497 (30%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1247045at2759
OrthoFinder 1 1.000 - - FOG0000016
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X23
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
43.920

Return to query results.
Submit another query.