DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cyp4g1 and cyp-31A5

DIOPT Version :9

Sequence 1:NP_525031.1 Gene:Cyp4g1 / 30986 FlyBaseID:FBgn0010019 Length:556 Species:Drosophila melanogaster
Sequence 2:NP_001343697.1 Gene:cyp-31A5 / 13198891 WormBaseID:WBGene00013381 Length:308 Species:Caenorhabditis elegans


Alignment Length:267 Identity:78/267 - (29%)
Similarity:127/267 - (47%) Gaps:21/267 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly    26 PMLTTLVGTLVAMALYEYWRRNSREYRMVANIPSPPELPILGQAHVA----AGLSNAEILAVGLG 86
            |.:.....|::|..:|::.|..    :::.::..|...||:|...:.    .|..|.   .:|:|
 Worm     6 PAVLLASATVIAWLIYKHLRMR----QVLKHLNQPRSYPIVGHGLITKPDPEGFMNQ---VIGMG 63

  Fly    87 YLNKYGETMKAWLGNVLLVFLTNPSDIELILSGHQHLTKAEEYRYFKPWFGDGLLISNGHHWRHH 151
            ||.........|:|....:.|.:...:|.|.|..:||.|...|...:||.|..:|.|....||..
 Worm    64 YLYPDPRMCLLWIGPFPCLMLYSADLVEPIFSSTKHLNKGFAYVLLEPWLGISILTSQKEQWRPK 128

  Fly   152 RKMIAPTFHQSILKSFVPTFVDHSKAVVAR---MGLEAGKSFDVHDYMSQTTVDILLSTAMGV-- 211
            ||::.||||..|||.|:|.|.:.||.::.:   :|: |.:..||...::..|:||:..|:||.  
 Worm   129 RKLLTPTFHYDILKDFLPIFNEQSKILIQKLCCLGV-ADEEVDVLSVITLCTLDIICETSMGKAI 192

  Fly   212 -KKLPEGNKSFEYAQAVVDMCDIIHKRQVKLLYRLDSIYKFTKLREKGDRMMNIILGMTSKVVKD 275
             .:|.|.|   ||..||..:..:|.||....|.....||..|:.....::.::|:...|.||:.:
 Worm   193 GAQLAENN---EYVWAVHTINKLISKRTNNPLMWNSFIYNLTEDGRTHEKCLHILHDFTKKVIVE 254

  Fly   276 RKENFQE 282
            |||..|:
 Worm   255 RKEALQD 261

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cyp4g1NP_525031.1 p450 58..518 CDD:278495 73/235 (31%)
cyp-31A5NP_001343697.1 p450 36..>261 CDD:325183 72/231 (31%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1247045at2759
OrthoFinder 1 1.000 - - FOG0000016
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X23
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
54.920

Return to query results.
Submit another query.