DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cyp4g1 and CYP4F22

DIOPT Version :9

Sequence 1:NP_525031.1 Gene:Cyp4g1 / 30986 FlyBaseID:FBgn0010019 Length:556 Species:Drosophila melanogaster
Sequence 2:NP_775754.2 Gene:CYP4F22 / 126410 HGNCID:26820 Length:531 Species:Homo sapiens


Alignment Length:540 Identity:157/540 - (29%)
Similarity:264/540 - (48%) Gaps:61/540 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly    32 VGTLVAMALYEYWR------RNSREY----RMVANIPSPPELP-ILGQAHVAAGLSNAEILAVGL 85
            |.||:...|:..:|      |..|.:    |.:...|.||... :||  |:...|.|...|....
Human    24 VSTLLLFLLFFLFRLLLRFLRLCRSFYITCRRLRCFPQPPRRNWLLG--HLGMYLPNEAGLQDEK 86

  Fly    86 GYLNKYGETMKAWLGNVL-LVFLTNPSDIELILSGHQHLTKAEE--YRYFKPWFGDGLLISNGHH 147
            ..|:.....:..|:|.|| |:.|.:|..|:.:|.....:...::  |.:.|||.|||||:|.|..
Human    87 KVLDNMHHVLLVWMGPVLPLLVLVHPDYIKPLLGASAAIAPKDDLFYGFLKPWLGDGLLLSKGDK 151

  Fly   148 WRHHRKMIAPTFHQSILKSFVPTF---VDHSKAVVARMGLEAGKSFDVHDYMSQTTVDILLSTAM 209
            |..||:::.|.||..|||.::..|   .|...|....:...:..|.|:.:::|..|:|.|.....
Human   152 WSRHRRLLTPAFHFDILKPYMKIFNQSADIMHAKWRHLAEGSAVSLDMFEHISLMTLDSLQKCVF 216

  Fly   210 GVKKLPEGNKSFEYAQAVVDMCDIIHKRQVKLLYRLDSIYKFTKLREKGDRMMNIILGMTSKVVK 274
            ......: .|..:|..|::::..:..:||.:|.:.||.||..:....:..:..:::...|::|::
Human   217 SYNSNCQ-EKMSDYISAIIELSALSVRRQYRLHHYLDFIYYRSADGRRFRQACDMVHHFTTEVIQ 280

  Fly   275 DRKENFQEESRAIVEEISTPVASTPASKKEGLRDDLDDIDENDVGAKRRLALLDAMVEMAKNPDI 339
            :|:...:::.           |......|:|  ..||.||          .||.|..|..|    
Human   281 ERRRALRQQG-----------AEAWLKAKQG--KTLDFID----------VLLLARDEDGK---- 318

  Fly   340 EWNEKDIMDEVNTIMFEGHDTTSAGSSFALCMMGIHKDIQAKVFAEQKAIFGDNMLRDCTFADTM 404
            |.:::||..|.:|.|||||||||:|.|:.|..:..:.:.|.|...|.:.:.....|.:..:.|..
Human   319 ELSDEDIRAEADTFMFEGHDTTSSGISWMLFNLAKYPEYQEKCREEIQEVMKGRELEELEWDDLT 383

  Fly   405 EMKYLERVILETLRLYPPVPLIARRLDYDLKLASGPYTVPKGTTVIVLQYCVHRRPDIYP----- 464
            ::.:....|.|:||.||||.|::|:...|:||..| ..:|||...:|..|..|..|.::|     
Human   384 QLPFTTMCIKESLRQYPPVTLVSRQCTEDIKLPDG-RIIPKGIICLVSIYGTHHNPTVWPDSKVY 447

  Fly   465 NPTKFDPDNFLPERMANRHYYSFIPFSAGPRSCVGRKYAMLKLKVLLS-TIVRNYIVHSTDTEAD 528
            ||.:|||||  |::   |...:::|||||||:|:|:.:||.:|:|::: |::|..:  |.|....
Human   448 NPYRFDPDN--PQQ---RSPLAYVPFSAGPRNCIGQSFAMAELRVVVALTLLRFRL--SVDRTRK 505

  Fly   529 FKLQADIILKLENGFNVSLE 548
            .:.:.::||:.|||..:.:|
Human   506 VRRKPELILRTENGLWLKVE 525

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cyp4g1NP_525031.1 p450 58..518 CDD:278495 141/472 (30%)
CYP4F22NP_775754.2 p450 60..524 CDD:278495 148/501 (30%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1247045at2759
OrthoFinder 1 1.000 - - FOG0000016
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X23
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
43.920

Return to query results.
Submit another query.