DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cyp4g1 and LOC103692784

DIOPT Version :9

Sequence 1:NP_525031.1 Gene:Cyp4g1 / 30986 FlyBaseID:FBgn0010019 Length:556 Species:Drosophila melanogaster
Sequence 2:XP_038935978.1 Gene:LOC103692784 / 103692784 RGDID:9252969 Length:337 Species:Rattus norvegicus


Alignment Length:355 Identity:101/355 - (28%)
Similarity:169/355 - (47%) Gaps:30/355 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly   196 MSQTTVDILLSTAMGVKKLPEGNKSFEYAQAVVDMCDIIHKRQVKLLYRLDSIYKFTKLREKGDR 260
            :|..|:|.|.....|.....:.:.| ||..|::::..:..||..:|...||.:|..|....:..:
  Rat     5 ISLMTLDSLQKCLFGFDSNCQESPS-EYISAILELSSLTIKRSYQLFLYLDFLYYRTADGRRFRK 68

  Fly   261 MMNIILGMTSKVVKDRKENFQEESRAIVEEISTPVASTPASKKEGLRDDLDDIDENDVGAKRRLA 325
            ..:::...|..|:::|:.....:.   |:|..       .||.:.....||.||          .
  Rat    69 ACDLVHSFTDAVIRERRRLLSSQG---VDEFL-------ESKTKSKSKTLDFID----------V 113

  Fly   326 LLDAMVEMAKNPDIEWNEKDIMDEVNTIMF--EGHDTTSAGSSFALCMMGIHKDIQAKVFAEQKA 388
            ||.|..|..|    |.:::||..|.:|.||  |.||||::..|:.|..:..|.:.|.....|...
  Rat   114 LLLAKDEHGK----ELSDEDIRAEADTFMFGDESHDTTASTLSWILYNLARHPEYQESCLQEVWE 174

  Fly   389 IFGDNMLRDCTFADTMEMKYLERVILETLRLYPPVPLIARRLDYDLKLASGPYTVPKGTTVIVLQ 453
            :..|....:..:.|..::.:|...|.|:|||:||...:.||...|:.|..| ..:|||...::..
  Rat   175 LLRDREPEEIEWDDLAQLPFLTMCIKESLRLHPPAVDLLRRCTQDIVLPDG-RVIPKGNICVISI 238

  Fly   454 YCVHRRPDIYPNPTKFDPDNFLPERMANRHYYSFIPFSAGPRSCVGRKYAMLKLKVLLSTIVRNY 518
            :.:|..|.::|:|..:||..|.||....|...||||||||||:|:|:.:||.::||.::..:..:
  Rat   239 FGIHHNPSVWPDPEVYDPFRFDPESRQKRSPLSFIPFSAGPRNCIGQTFAMNEMKVAVALTLLRF 303

  Fly   519 IVHSTDTEADFKLQADIILKLENGFNVSLE 548
            .:...|.|.  :.:.:|||:.|.|..:.:|
  Rat   304 RLLPDDKEP--RRKPEIILRAEGGLRLLVE 331

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cyp4g1NP_525031.1 p450 58..518 CDD:278495 93/323 (29%)
LOC103692784XP_038935978.1 cytochrome_P450 <1..328 CDD:425388 100/350 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1247045at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.