DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment ase and AT1G12540

DIOPT Version :9

Sequence 1:NP_476694.1 Gene:ase / 30985 FlyBaseID:FBgn0000137 Length:486 Species:Drosophila melanogaster
Sequence 2:NP_172715.4 Gene:AT1G12540 / 837810 AraportID:AT1G12540 Length:257 Species:Arabidopsis thaliana


Alignment Length:150 Identity:31/150 - (20%)
Similarity:50/150 - (33%) Gaps:50/150 - (33%)


- Green bases have known domain annotations that are detailed below.


  Fly    79 TNTTPISSQRKRPLG---ESQKQNRHNQQNQQLSKTSVPAKKCKTNKKLAVERPPKAGTISHPHK 140
            |.:|.:|.|..:|..   .|.......:||            |:|..           |:|...|
plant    26 TPSTRVSFQEPKPCNPVIHSAGIENDGRQN------------CETTM-----------TLSEIMK 67

  Fly   141 SQSDQSFGTPGRKGLPLPQAVARRNARERNRVKQVNNGFALLREKIPEEVSEAFEAQGAGRGASK 205
            ...:     |..|.       |:....||.|.::..:.|.:||..:|.:..:.            
plant    68 GDDE-----PKNKR-------AKHKELERQRRQENTSLFKILRYLLPSQYIKG------------ 108

  Fly   206 KLSKVETLRMAVEYIRSLEK 225
            |.|..:.:..||.||:.|:|
plant   109 KRSSADHVLEAVNYIKDLQK 128

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
aseNP_476694.1 HLH <172..224 CDD:278439 10/51 (20%)
AT1G12540NP_172715.4 HLH 75..127 CDD:278439 15/70 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR13935
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.