DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment ase and BHLH101

DIOPT Version :9

Sequence 1:NP_476694.1 Gene:ase / 30985 FlyBaseID:FBgn0000137 Length:486 Species:Drosophila melanogaster
Sequence 2:NP_196035.2 Gene:BHLH101 / 830293 AraportID:AT5G04150 Length:260 Species:Arabidopsis thaliana


Alignment Length:218 Identity:47/218 - (21%)
Similarity:88/218 - (40%) Gaps:46/218 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly   134 TISHPHKSQSDQSFGTPGRKGLPLPQAVARRNARERNRVKQVNNGFALLREKIPEEVSEAFEAQG 198
            ::||.:.:.|:.:......:|..:.:.....||.||:|.:::|..::.||..:|  :|:      
plant    60 SLSHSNNTNSNNNNYQEEDRGAVVLEKKLNHNASERDRRRKLNALYSSLRALLP--LSD------ 116

  Fly   199 AGRGASKKLSKVETLRMAVEYI-----------RSLEKLLGFDFPPLNSQGNSSGSGDDSFMFIK 252
                ..:|||...|:...|:||           |..|:||    ..::.:.:.....:.:.|   
plant   117 ----QKRKLSIPMTVARVVKYIPEQKQELQRLSRRKEELL----KRISRKTHQEQLRNKAMM--- 170

  Fly   253 DEFDCLDEHFDDSL-SNYEMDEQQTVQQTLSEDMLNPPQASDLLPSLTTLNGLQYIRIPGT---- 312
               |.:|......: :|:..|.:..||...|:    ....||:|..|.. |||..|.:..:    
plant   171 ---DSIDSSSSQRIAANWLTDTEIAVQIATSK----WTSVSDMLLRLEE-NGLNVISVSSSVSST 227

  Fly   313 -NTYQLLTTDLLGDLSHEQKLEE 334
             ..:..|...:.||.  :.:|||
plant   228 ARIFYTLHLQMRGDC--KVRLEE 248

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
aseNP_476694.1 HLH <172..224 CDD:278439 13/62 (21%)
BHLH101NP_196035.2 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR13935
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.