DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment ase and AT4G20970

DIOPT Version :9

Sequence 1:NP_476694.1 Gene:ase / 30985 FlyBaseID:FBgn0000137 Length:486 Species:Drosophila melanogaster
Sequence 2:NP_193829.2 Gene:AT4G20970 / 827844 AraportID:AT4G20970 Length:190 Species:Arabidopsis thaliana


Alignment Length:247 Identity:49/247 - (19%)
Similarity:84/247 - (34%) Gaps:91/247 - (36%)


- Green bases have known domain annotations that are detailed below.


  Fly   136 SHPHKSQSDQSFGTPGRKGLPLPQAVARRNARERNRVKQVNNGFALLREKIPEEVSEAFEAQGAG 200
            ||.:..||               ::|.|:.. |:||..|:.:.::.|...:|...|         
plant     4 SHSNTGQS---------------RSVDRKTV-EKNRRMQMKSLYSELISLLPHHSS--------- 43

  Fly   201 RGASKKLSKVETLRMAVEYIRSL----EK--------LLGFDFPPLNSQGNSSGSGDDSFMFIKD 253
               ::.|:..:.|..|..||:.|    ||        :.......|||.|:||.|..        
plant    44 ---TEPLTLPDQLDEAANYIKKLQVNVEKKRERKRNLVATTTLEKLNSVGSSSVSSS-------- 97

  Fly   254 EFDCLDEHFDDSLSNYEMDEQQTVQQTLSEDMLNPPQASDLLPSLTTLNGLQYIRIPGTNTYQLL 318
                :|......|...|:.|..::....            |:.||.  :...:..|     .::|
plant    98 ----VDVSVPRKLPKIEIQETGSIFHIF------------LVTSLE--HKFMFCEI-----IRVL 139

  Fly   319 TTDLLGDLSH--------------EQKLEETAASGQLSRSPVP---QKVVRS 353
            |.:|..:::|              ..|:||....   :||.:|   :|:|.|
plant   140 TEELGAEITHAGYSIVDDAVFHTLHCKVEEHDYG---ARSQIPERLEKIVNS 188

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
aseNP_476694.1 HLH <172..224 CDD:278439 10/55 (18%)
AT4G20970NP_193829.2 bHLH_AtORG2_like 12..87 CDD:381484 17/87 (20%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR13935
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.