DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment ase and Tcf23

DIOPT Version :9

Sequence 1:NP_476694.1 Gene:ase / 30985 FlyBaseID:FBgn0000137 Length:486 Species:Drosophila melanogaster
Sequence 2:XP_001067558.2 Gene:Tcf23 / 688600 RGDID:1586500 Length:215 Species:Rattus norvegicus


Alignment Length:238 Identity:57/238 - (23%)
Similarity:89/238 - (37%) Gaps:68/238 - (28%)


- Green bases have known domain annotations that are detailed below.


  Fly    88 RKRP-----LGESQKQNRHNQQNQQL-SKTSVPAKKCKTNKKLAVERPPKAGTISHPHKSQSDQS 146
            |.:|     ||..:|::|.|:..|.| ..||      .:|.:|       :...|.|.::::.  
  Rat    16 RNKPKARLLLGTDRKRSRLNRTRQDLWDDTS------WSNHRL-------SRVTSAPRRTRAR-- 65

  Fly   147 FGTP-GRKGLPLPQAVARRNARERNRVKQVNNGFALLREKIPEEVSEAFEAQGAGRGASKKLSKV 210
             ||. ||.     :|.....||||.|||.:...|..|:..:|....:.            ||||:
  Rat    66 -GTAHGRS-----EASPENAARERTRVKTLRQAFLALQAALPAVPPDT------------KLSKL 112

  Fly   211 ETLRMAVEYIRSLEKLLGFDFP--------------------PLNSQGNSSGSGDDSFMFIKDEF 255
            :.|.:|..||..|.:.||.:.|                    |:.|:..:.|.|...     .|.
  Rat   113 DVLVLATSYIAHLTRTLGHELPGPAWPPFLRGLRYLHPLKKWPMRSRLYAGGLGCSG-----PES 172

  Fly   256 DCLDEHFDDSLSNYEMDEQQTVQQTLSEDMLNPPQASDLLPSL 298
            ...|.....:..:...|.|...|.:::.|.|   .||.:.|:|
  Rat   173 TTADSTTTIATDHRSRDAQLGSQVSVATDSL---LASPVSPAL 212

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
aseNP_476694.1 HLH <172..224 CDD:278439 13/51 (25%)
Tcf23XP_001067558.2 HLH 80..129 CDD:197674 19/60 (32%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG4029
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.