DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment ase and TAL1

DIOPT Version :9

Sequence 1:NP_476694.1 Gene:ase / 30985 FlyBaseID:FBgn0000137 Length:486 Species:Drosophila melanogaster
Sequence 2:NP_001274276.1 Gene:TAL1 / 6886 HGNCID:11556 Length:331 Species:Homo sapiens


Alignment Length:352 Identity:80/352 - (22%)
Similarity:114/352 - (32%) Gaps:97/352 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly    11 PPKENPKENP----NPGIKTTLKPFGKITVHNVLSESGANALQQHIANQNTIIRKIRDFGMLGAV 71
            ||.|..:.:|    ....:.::.|     .|.||....|....:..|.:..:|    :.|..|..
Human     5 PPSEAARSDPQLEGRDAAEASMAP-----PHLVLLNGVAKETSRAAAAEPPVI----ELGARGGP 60

  Fly    72 QSAAASTTNTTPISSQRKRPLGESQKQNRHNQQNQQLSK----------TSVPAKKCKTNKKLAV 126
            ....|...........|.....|:    ||.....:|.:          .||.|:.....:.:.:
Human    61 GGGPAGGGGAARDLKGRDAATAEA----RHRVPTTELCRPPGPAPAPAPASVTAELPGDGRMVQL 121

  Fly   127 ERPPKAG----------TISHPHKSQSDQSFGTPGR----------KGLPLP----------QAV 161
            ..|..|.          ::|.|..|.....||.|..          |..|.|          ..|
Human   122 SPPALAAPAAPGRALLYSLSQPLASLGSGFFGEPDAFPMFTTNNRVKRRPSPYEMEITDGPHTKV 186

  Fly   162 ARR---NARERNRVKQVNNGFALLREKIPEEVSEAFEAQGAGRGASKKLSKVETLRMAVEYIRSL 223
            .||   |:|||.|.:.||..||.||:.||....:            |||||.|.||:|::||..|
Human   187 VRRIFTNSRERWRQQNVNGAFAELRKLIPTHPPD------------KKLSKNEILRLAMKYINFL 239

  Fly   224 EKLL-------------GFDFPPLNSQGNSSGSG-----DDSFMFIKDEFDCLDEHFDDSLSNYE 270
            .|||             |.| |.:.:.|...|.|     ||....:...........|.:.|...
Human   240 AKLLNDQEEEGTQRAKTGKD-PVVGAGGGGGGGGGGAPPDDLLQDVLSPNSSCGSSLDGAASPDS 303

  Fly   271 MDEQQTVQQTLSEDMLNPPQASDLLPS 297
            ..|:...:.|...  |:|.    :||:
Human   304 YTEEPAPKHTARS--LHPA----MLPA 324

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
aseNP_476694.1 HLH <172..224 CDD:278439 19/51 (37%)
TAL1NP_001274276.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..27 4/21 (19%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 40..86 7/53 (13%)
HLH 193..243 CDD:197674 26/61 (43%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 249..331 16/83 (19%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG4029
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.