DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment ase and Scx

DIOPT Version :9

Sequence 1:NP_476694.1 Gene:ase / 30985 FlyBaseID:FBgn0000137 Length:486 Species:Drosophila melanogaster
Sequence 2:NP_001123980.1 Gene:Scx / 680712 RGDID:1588254 Length:209 Species:Rattus norvegicus


Alignment Length:161 Identity:45/161 - (27%)
Similarity:61/161 - (37%) Gaps:46/161 - (28%)


- Green bases have known domain annotations that are detailed below.


  Fly    91 PLGESQKQNRHNQQNQQLSKTSVPAKKC-------KTNKKLAVERPPKAGTISHPHKSQSDQSFG 148
            ||.|.:.:...:..:.: ....|.|.:|       :...:.|....|..|              |
  Rat    22 PLSEDEDRGSESSGSDE-KPCRVHAARCGLQGARRRAGGRRAAGSGPGPG--------------G 71

  Fly   149 TPGRKGLPLPQAVARRNARERNRVKQVNNGFALLREKIPEEVSEAFEAQGAGRGASKKLSKVETL 213
            .|||:    |:.....|||||:|...||..|..||..||.|            .|.:||||:|||
  Rat    72 RPGRE----PRQRHTANARERDRTNSVNTAFTALRTLIPTE------------PADRKLSKIETL 120

  Fly   214 RMAVEYIRSLEKLLGFDFPPLNSQGNSSGSG 244
            |:|..||..|..:|        ..|.:.|.|
  Rat   121 RLASSYISHLGNVL--------LVGEACGDG 143

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
aseNP_476694.1 HLH <172..224 CDD:278439 20/51 (39%)
ScxNP_001123980.1 bHLH_TS_scleraxis 76..143 CDD:381521 31/90 (34%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG4029
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.