DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment ase and Ascl4

DIOPT Version :9

Sequence 1:NP_476694.1 Gene:ase / 30985 FlyBaseID:FBgn0000137 Length:486 Species:Drosophila melanogaster
Sequence 2:NP_001157086.1 Gene:Ascl4 / 67341 MGIID:1914591 Length:144 Species:Mus musculus


Alignment Length:147 Identity:48/147 - (32%)
Similarity:68/147 - (46%) Gaps:37/147 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly   126 VERPPKAGTISHPHKSQSDQSFGTPGRK--------------------GLPL-----PQAVARRN 165
            :|:...||.::.|...::......|||:                    .|||     |..:.:||
Mouse     1 MEKRRSAGLLALPSALRTAPLGALPGREPCRVSVRQDAADCARRRPYSSLPLGGVAEPAFLRQRN 65

  Fly   166 ARERNRVKQVNNGFALLREKIPEEVSEAFEAQGAGRGASKKLSKVETLRMAVEYIRSLEKLLGFD 230
            .|||.||:.||.|:|.||:.:|.|:            |.::||||||||.|:.||:.|::||...
Mouse    66 ERERQRVRCVNEGYARLRQHLPREL------------AGQRLSKVETLRAAISYIKQLQELLERH 118

  Fly   231 FPPLNSQGNSSGSGDDS 247
            .|..||.|.|..|...|
Mouse   119 RPDCNSDGESKASSGAS 135

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
aseNP_476694.1 HLH <172..224 CDD:278439 21/51 (41%)
Ascl4NP_001157086.1 HLH 72..116 CDD:197674 23/55 (42%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C167848562
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG4029
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 1 1.000 - - mtm8863
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
43.740

Return to query results.
Submit another query.