DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment ase and Ascl1

DIOPT Version :9

Sequence 1:NP_476694.1 Gene:ase / 30985 FlyBaseID:FBgn0000137 Length:486 Species:Drosophila melanogaster
Sequence 2:NP_071779.1 Gene:Ascl1 / 64186 RGDID:71010 Length:233 Species:Rattus norvegicus


Alignment Length:230 Identity:78/230 - (33%)
Similarity:102/230 - (44%) Gaps:52/230 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly    73 SAAASTTNTTPISSQRKRPLGESQKQNRHNQQNQQLSKTSVPAKKCKTNKKLAVERPPKAGTISH 137
            :|||:.......|:|      :.|:|....||..|||..:........:|..|  :..|....|.
  Rat    34 AAAAAAAAAAAQSAQ------QQQQQQAPQQQAPQLSPVADGQPSGGGHKSAA--KQVKRQRSSS 90

  Fly   138 PHKSQSDQSFGTPGRKGLPLPQ----AVARRNARERNRVKQVNNGFALLREKIPEEVSEAFEAQG 198
            |...:..:.....| .|..|||    ||||||.|||||||.||.|||.|||.:|         .|
  Rat    91 PELMRCKRRLNFSG-FGYSLPQQQPAAVARRNERERNRVKLVNLGFATLREHVP---------NG 145

  Fly   199 AGRGASKKLSKVETLRMAVEYIRSLEKLL--------GFDFPPLNSQGNSSGSGDDSFMFIKDEF 255
            |   |:||:|||||||.||||||:|::||        .|....|:...:.:.|.|          
  Rat   146 A---ANKKMSKVETLRSAVEYIRALQQLLDEHDAVSAAFQAGVLSPTISPNYSND---------- 197

  Fly   256 DCLDEHFDDSLSNYEMDEQQTVQQTLSEDMLNPPQ 290
              |:......:|:|..||.       |.|.|:|.:
  Rat   198 --LNSMAGSPVSSYSSDEG-------SYDPLSPEE 223

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
aseNP_476694.1 HLH <172..224 CDD:278439 29/51 (57%)
Ascl1NP_071779.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..24
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 39..95 14/63 (22%)
HLH 131..173 CDD:197674 30/53 (57%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C166352164
Domainoid 1 1.000 67 1.000 Domainoid score I9554
eggNOG 1 0.900 - - E1_KOG4029
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1131543at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 1 1.000 - - mtm9108
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - LDO PTHR13935
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
76.900

Return to query results.
Submit another query.