DRSC - DRSC Integrative Ortholog Prediction Tool

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits

Protein Alignment ase and Hand1

DIOPT Version :9

Sequence 1:	NP_476694.1	Gene:	ase / 30985	FlyBaseID:	FBgn0000137	Length:	486	Species:	Drosophila melanogaster
Sequence 2:	NP_067603.1	Gene:	Hand1 / 59112	RGDID:	621206	Length:	216	Species:	Rattus norvegicus

Alignment Length:	143	Identity:	41/143 - (28%)
Similarity:	56/143 - (39%)	Gaps:	46/143 - (32%)

- Green bases have known domain annotations that are detailed below.

  Fly   114 PAKKCKTNKKLAVERP----------------PKAGTISHPHKSQSDQSFG-------TPGR--- 152
            ||.:|..      |||                |..|  ..|..:.:..::|       :|||
  Rat    31 PASRCHQ------ERPYFQSWLLSPADAAPDFPAGG--PPPTTAVAAAAYGPDARPSQSPGRLEA 87

  Fly   153 KGLPLPQAVARRNARERNRVKQVNNGFALLREKIPEEVSEAFEAQGAGRGASKKLSKVETLRMAV 217
            .|..||:.......:||.|.:.:|:.||.|||.||..            .|..||||::|||:|.
  Rat    88 LGGRLPRRKGSGPKKERRRTESINSAFAELRECIPNV------------PADTKLSKIKTLRLAT 140

  Fly   218 EYIRSLEKLLGFD 230
            .||..|..:|..|
  Rat   141 SYIAYLMDVLAKD 153

Known Domains:

Indicated by green bases in alignment.

Gene	Sequence	Domain	Region	External ID	Identity
ase	NP_476694.1	HLH	<172..224	CDD:278439	19/51 (37%)
Hand1	NP_067603.1	Disordered. /evidence=ECO:0000256\|SAM:MobiDB-lite	1..20
		Disordered. /evidence=ECO:0000256\|SAM:MobiDB-lite	73..109		10/35 (29%)
		HLH	103..152	CDD:197674	24/60 (40%)
		Disordered. /evidence=ECO:0000256\|SAM:MobiDB-lite	165..203
Blue background indicates that the domain is not in the aligned region.

Information from Original Tools:

Tool	Simple Score	Weighted Score	Original Tool Information
Tool	Simple Score	Weighted Score	BLAST Result	Score	Score Type	Cluster ID
Compara	0	0.000	Not matched by this tool.
Domainoid	0	0.000	Not matched by this tool.
eggNOG	1	0.900	-	-		E1_KOG4029
Hieranoid	0	0.000	Not matched by this tool.
Homologene	0	0.000	Not matched by this tool.
Inparanoid	0	0.000	Not matched by this tool.
OMA	0	0.000	Not matched by this tool.
OrthoDB	0	0.000	Not matched by this tool.
OrthoFinder	0	0.000	Not matched by this tool.
OrthoInspector	0	0.000	Not matched by this tool.
orthoMCL	0	0.000	Not matched by this tool.
Panther	0	0.000	Not matched by this tool.
Phylome	0	0.000	Not matched by this tool.
SonicParanoid	0	0.000	Not matched by this tool.
SwiftOrtho	0	0.000	Not matched by this tool.
TreeFam	0	0.000	Not matched by this tool.
	1	0.900