DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment ase and Ascl3

DIOPT Version :9

Sequence 1:NP_476694.1 Gene:ase / 30985 FlyBaseID:FBgn0000137 Length:486 Species:Drosophila melanogaster
Sequence 2:NP_064435.1 Gene:Ascl3 / 56787 MGIID:1928820 Length:174 Species:Mus musculus


Alignment Length:113 Identity:42/113 - (37%)
Similarity:56/113 - (49%) Gaps:29/113 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly   144 DQSFGTPGRKGLPLPQAVARRNARERNRVKQVNNGFALLREKIPEEVSEAFEAQGAGRGASKKLS 208
            |.::|         |..:.:||.|||.|||.||.|:|.||..:||:..|            |:||
Mouse    86 DYTYG---------PAFIRKRNERERQRVKCVNEGYARLRRHLPEDYLE------------KRLS 129

  Fly   209 KVETLRMAVEYIRSLEKLLGFDFP-----PLNSQGNSSGSGDDSFMFI 251
            ||||||.|::||..|:.||   :|     ..|.:..|.||.|.:...|
Mouse   130 KVETLRAAIKYISYLQSLL---YPDESETKKNPRTASCGSLDPALRVI 174

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
aseNP_476694.1 HLH <172..224 CDD:278439 23/51 (45%)
Ascl3NP_064435.1 HLH 95..145 CDD:278439 29/61 (48%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 153..174 5/20 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C167848560
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG4029
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 1 1.000 - - mtm8863
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R3926
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
54.770

Return to query results.
Submit another query.