DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment ase and figla

DIOPT Version :9

Sequence 1:NP_476694.1 Gene:ase / 30985 FlyBaseID:FBgn0000137 Length:486 Species:Drosophila melanogaster
Sequence 2:NP_001016342.1 Gene:figla / 549096 XenbaseID:XB-GENE-966403 Length:203 Species:Xenopus tropicalis


Alignment Length:141 Identity:39/141 - (27%)
Similarity:60/141 - (42%) Gaps:33/141 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly   124 LAVERPPK-AGTISHPHKSQSDQSFGTPGRKGLP---------LPQAVARR---NARERNRVKQV 175
            |.|..||: .|.:...|.:...........|.||         ..:.:.||   ||:||.|::.:
 Frog    10 LCVTPPPELLGEVLREHYTPLPYMASINKMKRLPSGHYFCMENFEEVLERRQAANAKERERIRNI 74

  Fly   176 NNGFALLREKIPEEVSEAFEAQGAGRGASKKLSKVETLRMAVEYIRSLEKLL----GF----DFP 232
            |:||:.|:..:|....:            :|.|||:||:.|.||||.|..:|    ||    |.|
 Frog    75 NSGFSKLKTIVPLIPKD------------RKPSKVDTLKAATEYIRLLHDILEETGGFEKVEDLP 127

  Fly   233 PLNSQGNSSGS 243
            .:......:|:
 Frog   128 DIELTDRYAGT 138

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
aseNP_476694.1 HLH <172..224 CDD:278439 16/51 (31%)
figlaNP_001016342.1 HLH 58..115 CDD:238036 24/68 (35%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.