DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment ase and ASCL1

DIOPT Version :9

Sequence 1:NP_476694.1 Gene:ase / 30985 FlyBaseID:FBgn0000137 Length:486 Species:Drosophila melanogaster
Sequence 2:NP_004307.2 Gene:ASCL1 / 429 HGNCID:738 Length:236 Species:Homo sapiens


Alignment Length:271 Identity:86/271 - (31%)
Similarity:110/271 - (40%) Gaps:74/271 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly    42 ESGANALQQHIANQNTIIRKIRDFGMLGAVQSAAASTTNTTPISSQRKRPLGESQKQNRHNQQNQ 106
            |||....|.....|...:.....|....|..:|||:..            ..:|.:|.:..||.|
Human     8 ESGGAGQQPQPQPQQPFLPPAACFFATAAAAAAAAAAA------------AAQSAQQQQQQQQQQ 60

  Fly   107 QLSKTSVPAKKCKTNKKLAVERPPKAGTISHP-----HKSQSDQSFGTPGRK-----GLPLPQ-- 159
            |.:....||         |..:|...|..|.|     .:|.|.:......|.     |..|||  
Human    61 QQAPQLRPA---------ADGQPSGGGHKSAPKQVKRQRSSSPELMRCKRRLNFSGFGYSLPQQQ 116

  Fly   160 --AVARRNARERNRVKQVNNGFALLREKIPEEVSEAFEAQGAGRGASKKLSKVETLRMAVEYIRS 222
              ||||||.|||||||.||.|||.|||.:|         .||   |:||:|||||||.||||||:
Human   117 PAAVARRNERERNRVKLVNLGFATLREHVP---------NGA---ANKKMSKVETLRSAVEYIRA 169

  Fly   223 LEKLL--------GFDFPPLNSQGNSSGSGDDSFMFIKDEFDCLDEHFDDSLSNYEMDEQQTVQQ 279
            |::||        .|....|:...:.:.|.|            |:......:|:|..||.     
Human   170 LQQLLDEHDAVSAAFQAGVLSPTISPNYSND------------LNSMAGSPVSSYSSDEG----- 217

  Fly   280 TLSEDMLNPPQ 290
              |.|.|:|.:
Human   218 --SYDPLSPEE 226

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
aseNP_476694.1 HLH <172..224 CDD:278439 29/51 (57%)
ASCL1NP_004307.2 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..26 5/17 (29%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 42..98 16/76 (21%)
bHLH_TS_ASCL1_Mash1 115..185 CDD:381585 43/81 (53%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165158181
Domainoid 1 1.000 68 1.000 Domainoid score I9706
eggNOG 1 0.900 - - E1_KOG4029
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1131543at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - LDO PTHR13935
Phylome 00.000 Not matched by this tool.
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R3926
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
User_Submission 00.000 Not matched by this tool.
76.930

Return to query results.
Submit another query.