DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment ase and LYL1

DIOPT Version :9

Sequence 1:NP_476694.1 Gene:ase / 30985 FlyBaseID:FBgn0000137 Length:486 Species:Drosophila melanogaster
Sequence 2:NP_005574.2 Gene:LYL1 / 4066 HGNCID:6734 Length:280 Species:Homo sapiens


Alignment Length:254 Identity:61/254 - (24%)
Similarity:83/254 - (32%) Gaps:95/254 - (37%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MAALSFSPSPPPKENPKENPNPGIKTTLKPFGKITVHNVLSESGANALQQHIANQNTIIRKIRDF 65
            :.|.|.:|:||||   ..:|.|                                     .::.:.
Human    21 VCAPSPAPAPPPK---PASPGP-------------------------------------PQVEEV 45

  Fly    66 GMLGAVQSAAASTTNTTP----ISSQRKRPLGESQKQNRHNQQNQQLSKTSVPAKKCKTNKKLAV 126
            |..|     .:|.....|    ||....||.|.:       ....:|.....|..:..|    ..
Human    46 GHRG-----GSSPPRLPPGVPVISLGHSRPPGVA-------MPTTELGTLRPPLLQLST----LG 94

  Fly   127 ERPPKAGTISHPHKSQSDQSFGTPG---------RKGLP-----------LPQAVARR---NARE 168
            ..||......|||...:....|..|         .|..|           .||.||||   |:||
Human    95 TAPPTLALHYHPHPFLNSVYIGPAGPFSIFPSSRLKRRPSHCELDLAEGHQPQKVARRVFTNSRE 159

  Fly   169 RNRVKQVNNGFALLREKIPEEVSEAFEAQGAGRGASKKLSKVETLRMAVEYIRSLEKLL 227
            |.|.:.||..||.||:.:|....:            :||||.|.||:|::||..|.:||
Human   160 RWRQQNVNGAFAELRKLLPTHPPD------------RKLSKNEVLRLAMKYIGFLVRLL 206

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
aseNP_476694.1 HLH <172..224 CDD:278439 17/51 (33%)
LYL1NP_005574.2 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..60 13/83 (16%)
HLH 156..208 CDD:197674 25/63 (40%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 214..280
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG4029
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.