DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment ase and ptf1a

DIOPT Version :9

Sequence 1:NP_476694.1 Gene:ase / 30985 FlyBaseID:FBgn0000137 Length:486 Species:Drosophila melanogaster
Sequence 2:NP_997524.1 Gene:ptf1a / 368662 ZFINID:ZDB-GENE-030616-579 Length:265 Species:Danio rerio


Alignment Length:120 Identity:36/120 - (30%)
Similarity:52/120 - (43%) Gaps:32/120 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly   141 SQSDQSFG--------TPGRKG------------LPLPQAVARRNARERNRVKQVNNGFALLREK 185
            |.|..|:|        :|.|.|            :.:.|.....|.|||.|::.:|:.|..||..
Zfish    77 SSSTFSYGCADSTSELSPHRDGGLLKRRRRMRSEVEMQQLRQAANVRERRRMQSINDAFEGLRSH 141

  Fly   186 IPEEVSEAFEAQGAGRGASKKLSKVETLRMAVEYIRSLEKLLGFDFPPLNSQGNS 240
            ||....|            |:||||:|||:|:.||..|.:|:..|.|..|...::
Zfish   142 IPTLPYE------------KRLSKVDTLRLAIGYINFLAELVQSDMPIRNPHSDA 184

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
aseNP_476694.1 HLH <172..224 CDD:278439 18/51 (35%)
ptf1aNP_997524.1 HLH 121..173 CDD:197674 25/63 (40%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG4029
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.