DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment ase and Ascl5

DIOPT Version :9

Sequence 1:NP_476694.1 Gene:ase / 30985 FlyBaseID:FBgn0000137 Length:486 Species:Drosophila melanogaster
Sequence 2:XP_017454536.1 Gene:Ascl5 / 363991 RGDID:1561854 Length:188 Species:Rattus norvegicus


Alignment Length:232 Identity:66/232 - (28%)
Similarity:88/232 - (37%) Gaps:80/232 - (34%)


- Green bases have known domain annotations that are detailed below.


  Fly    54 NQNTIIRKIRDFGMLGAVQSAAASTTNTTPISSQRKRPLGESQKQNRHNQQNQQLSKTSVPAKKC 118
            |.| ..|.:.|.|..|.:|....:....||:::  ..|||                  :||    
  Rat     2 NSN-FCRALVDRGSPGGIQLGVVAPAGPTPLAA--TEPLG------------------NVP---- 41

  Fly   119 KTNKKLAVERPPKAGTISHPHKSQSDQSFGT------PGRKGL---PL-PQAVARRNARERNRVK 173
                  .:..|      .|...|..|...|.      ||..|:   |. |..:.:||.|||.|||
  Rat    42 ------FLLYP------GHSEPSYYDAYTGVFPYVPFPGAFGVYDYPFEPAFIQKRNERERQRVK 94

  Fly   174 QVNNGFALLREKIPEEVSEAFEAQGAGRGASKKLSKVETLRMAVEYIRSLEKLL----------G 228
            .||.|:|.||..:|            |..|.|:||||||||.|:.||:.|::||          .
  Rat    95 CVNEGYARLRGHLP------------GALAEKRLSKVETLRAAIRYIKYLQELLSAAPDGAPPTA 147

  Fly   229 FDFPPLNS-QGN----------SSGSGDDSFMFIKDE 254
            ...||.:: .||          ||||......|::.|
  Rat   148 TSPPPAHAGHGNALQPPSLVAESSGSSFSPSPFLESE 184

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
aseNP_476694.1 HLH <172..224 CDD:278439 23/51 (45%)
Ascl5XP_017454536.1 HLH 86..136 CDD:197674 29/61 (48%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C166352162
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG4029
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 1 1.000 - - mtm12323
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
43.740

Return to query results.
Submit another query.